DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10357 and Lipc

DIOPT Version :9

Sequence 1:NP_647821.2 Gene:CG10357 / 38435 FlyBaseID:FBgn0035453 Length:321 Species:Drosophila melanogaster
Sequence 2:XP_006243421.1 Gene:Lipc / 24538 RGDID:3009 Length:510 Species:Rattus norvegicus


Alignment Length:320 Identity:91/320 - (28%)
Similarity:144/320 - (45%) Gaps:63/320 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 LKPSADVSLENVEQLSSVESVKLIVHGYLG--SCTHGS---------------IMPLRNAYTAQG 82
            |:|....:|:.. ..:|...:.:|:||:.|  |.|.|.               |..:..|..::.
  Rat    65 LRPQHPETLQEC-GFNSSHPLVMIIHGWSGSESATVGKDSDNDSQVDGLLETWIWKIVGALKSRQ 128

  Fly    83 YE--NVLVADWGPVANLDYPSSRLAVKN---VAQILAKL---LEEFLQRHGISLEGVHVIGHSLG 139
            .:  ||.:.||   .:|.|....:||:|   |.|.:|.|   |||.::   .|...||:||:|||
  Rat   129 SQPVNVGLVDW---ISLAYQHYAIAVRNTRVVGQEVAALLLWLEESMK---FSRSKVHLIGYSLG 187

  Fly   140 AHIAGRIGRYFNG--SLGRVTGLDPALPLFSSRS-DDSLHSNAAQFVDVIHTDYPLF-------- 193
            ||::|..|....|  .:||:||||||.|:|...| ::.|..:.|.|||.|||    |        
  Rat   188 AHVSGFAGSSMGGKRKIGRITGLDPAGPMFEGTSPNERLSPDDANFVDAIHT----FTREHMGLS 248

  Fly   194 -GDIRPRGTVDFYPNFGLAPQPGCENVDV---VAASKL--LHEAYSCSHNRAVMFYAESIGMPEN 252
             |..:|....|||||.| :.||||..:::   :|...|  :.:...|:|.|:|..:.:|: ...|
  Rat   249 VGIKQPIAHYDFYPNGG-SFQPGCHFLELYKHIAEHGLNAITQTIKCAHERSVHLFIDSL-QHSN 311

  Fly   253 FPAVSCSLTAIKSRRVEDCLR-EKSKTNT-------ENANDYQTVFMGEHVNRSATLYYY 304
            ........:.:.|.....||. :|.:.|:       :.....:|:|:.........:|:|
  Rat   312 LQNTGFQCSNMDSFSQGLCLNCKKGRCNSLGYDIRRDRPRKSKTLFLITRAQSPFKVYHY 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10357NP_647821.2 Pancreat_lipase_like 28..308 CDD:238363 91/320 (28%)
LipcXP_006243421.1 Lipase 18..366 CDD:278576 89/313 (28%)
Pancreat_lipase_like 47..362 CDD:238363 89/309 (29%)
PLAT_LPL 369..504 CDD:238856 2/3 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.