DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10357 and Pnliprp2

Sequence 1:NP_647821.2 Gene:CG10357 FlyBaseID:FBgn0035453 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_035258.2 Gene:Pnliprp2 MGIID:1336202 Length:482 Species:Mus musculus

Alignment Length:327 Identity:92/328 (28%)
Similarity:140/328 (43%) Gaps:47/328 (14%)


  Fly    33 YYLKPSADVSLENVEQLSSVESVKLIVHGYLGSCTHGSIMPLRNAYTAQGYENVLVADWGPVANL 97
            |.:..:.|.:..|..........:.|:||::.....|.::.:..........|.:..||...:..
Mouse    80 YQIISATDPATINASNFQLDRKTRFIIHGFIDKGEEGWLLDMCKKMFQVEKVNCICVDWKRGSRT 144

  Fly    98 DYPSSRLAVKNVAQILAKLLEEFLQRHGISLEGVHVIGHSLGAHIAGRIGRYFNGSLGRVTGLDP 162
            :|..:....:.|...:|.|::......|.|.|.||:||||||:|:||..||...|.:||:|||||
Mouse   145 EYTQASYNTRVVGAEIAFLVQVLSTEMGYSPENVHLIGHSLGSHVAGEAGRRLEGHVGRITGLDP 209

  Fly   163 ALPLFSSRSDD-SLHSNAAQFVDVIHTD------YPLFGDIRPRGTVDFYPNFGLAPQPGCEN-- 218
            |.|.|....:: .|..:.|.||||||||      |..||..:..|.:||:||.| ...|||:.  
Mouse   210 AEPCFQGLPEEVRLDPSDAMFVDVIHTDSAPIIPYLGFGMSQKVGHLDFFPNGG-KEMPGCQKNI 273

  Fly   219 ----VDVVAASKLLHEAYSCSHNRAVMFYAESIGMPENFPAVSCSLTAIKSRRVEDCL------- 272
                ||:....:......:|:|.|:..:||.||..|:.|....||  :.:..:..||.       
Mouse   274 LSTIVDINGIWEGTRNFAACNHLRSYKYYASSILNPDGFLGYPCS--SYEKFQHNDCFPCPEQGC 336

  Fly   273 --------REKSKTNTENANDYQTVFMGEHVNRSATLYYY---LETNGAPP---------YGQGR 317
                    :.:.||.|..    ||.|:....:.:.|.:.|   :..:||..         ||...
Mouse   337 PKMGHYADQFEGKTATVE----QTFFLNTGDSGNFTRWRYKVSVTLSGAKKLSGYILVALYGCNG 397

  Fly   318 NS 319
            ||
Mouse   398 NS 399

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10357NP_647821.2 Pancreat_lipase_like 28..308 CDD:238363 86/306 (28%)
Pnliprp2NP_035258.2 Lipase 31..367 CDD:278576 84/294 (29%)
Pancreat_lipase_like 65..363 CDD:238363 84/290 (29%)
PLAT_PL 370..482 CDD:238857 7/31 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11610
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.