| Sequence 1: | NP_647821.2 | Gene: | CG10357 / 38435 | FlyBaseID: | FBgn0035453 | Length: | 321 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_035258.2 | Gene: | Pnliprp2 / 18947 | MGIID: | 1336202 | Length: | 482 | Species: | Mus musculus |
| Alignment Length: | 327 | Identity: | 92/327 - (28%) |
|---|---|---|---|
| Similarity: | 140/327 - (42%) | Gaps: | 47/327 - (14%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 33 YYLKPSADVSLENVEQLSSVESVKLIVHGYLGSCTHGSIMPLRNAYTAQGYENVLVADWGPVANL 97
Fly 98 DYPSSRLAVKNVAQILAKLLEEFLQRHGISLEGVHVIGHSLGAHIAGRIGRYFNGSLGRVTGLDP 162
Fly 163 ALPLFSSRSDD-SLHSNAAQFVDVIHTD------YPLFGDIRPRGTVDFYPNFGLAPQPGCEN-- 218
Fly 219 ----VDVVAASKLLHEAYSCSHNRAVMFYAESIGMPENFPAVSCSLTAIKSRRVEDCL------- 272
Fly 273 --------REKSKTNTENANDYQTVFMGEHVNRSATLYYY---LETNGAPP---------YGQGR 317
Fly 318 NS 319 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG10357 | NP_647821.2 | Pancreat_lipase_like | 28..308 | CDD:238363 | 86/305 (28%) |
| Pnliprp2 | NP_035258.2 | Lipase | 31..367 | CDD:278576 | 84/293 (29%) |
| Pancreat_lipase_like | 65..363 | CDD:238363 | 84/289 (29%) | ||
| Required for galactolipase activity. /evidence=ECO:0000250|UniProtKB:P54317 | 106..118 | 3/11 (27%) | |||
| Required for galactolipase activity. /evidence=ECO:0000250|UniProtKB:P54317 | 270..292 | 2/21 (10%) | |||
| PLAT_PL | 370..482 | CDD:238857 | 7/30 (23%) |
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_28N19 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | O | PTHR11610 |
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 3 | 2.910 | |||||