DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10357 and Pnliprp1

Sequence 1:NP_647821.2 Gene:CG10357 FlyBaseID:FBgn0035453 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_061362.1 Gene:Pnliprp1 MGIID:97723 Length:473 Species:Mus musculus

Alignment Length:300 Identity:84/300 (28%)
Similarity:131/300 (44%) Gaps:36/300 (12%)


  Fly    39 ADVSLENVEQLSSVESVKLIVHGYLGSCTHGSIMPL-RNAYTAQGYENVLVADWGPVANLDYPSS 102
            :|.|.............:.|:||::.......::.: :|.:..:.. |.:..||...:...|..:
Mouse    73 SDPSTIEASNFQVARKTRFIIHGFIDKGEENWVVDMCKNMFQVEEV-NCICVDWKRGSQTTYTQA 136

  Fly   103 RLAVKNVAQILAKLLEEFLQRHGISLEGVHVIGHSLGAHIAGRIGRYFNGSLGRVTGLDPALPLF 167
            ...|:.|...:|::::..::....|...||:||||||||:||..|....| |||:|||||....|
Mouse   137 ANNVRVVGAQVAQMIDILVRNFNYSASKVHLIGHSLGAHVAGEAGSRTPG-LGRITGLDPVEANF 200

  Fly   168 SSRSDD-SLHSNAAQFVDVIHTD-YPL-----FGDIRPRGTVDFYPNFGLAPQPGCEN------V 219
            ....:: .|..:.|.|||||||| .||     ||..:..|..||:||.| ...|||:.      |
Mouse   201 EGTPEEVRLDPSDADFVDVIHTDAAPLIPFLGFGTNQMVGHFDFFPNGG-QYMPGCKKNALSQIV 264

  Fly   220 DVVAASKLLHEAYSCSHNRAVMFYAESIGMPENFPAVSC-SLTAIKSRRVEDCLREKSKTNTENA 283
            |:........:..:|:|.|:..:|.|||..|:.|.|..| |....:|.:...|            
Mouse   265 DIDGIWSGTRDFVACNHLRSYKYYLESILNPDGFAAYPCASYRDFESNKCFPC------------ 317

  Fly   284 NDYQTVFMGEHVNRSAT------LYYYLETNGAPPYGQGR 317
            .|.....||.:.::.|.      ..::|.|..|..:.:.|
Mouse   318 PDQGCPQMGHYADKFANNTSVEPQKFFLNTGEAKNFARWR 357

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10357NP_647821.2 Pancreat_lipase_like 28..308 CDD:238363 82/290 (28%)
Pnliprp1NP_061362.1 Lipase 18..353 CDD:278576 83/295 (28%)
Pancreat_lipase_like 52..349 CDD:238363 82/291 (28%)
PLAT_PL 356..467 CDD:238857 1/2 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11610
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.