DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10357 and LIPI

Sequence 1:NP_647821.2 Gene:CG10357 FlyBaseID:FBgn0035453 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_945347.2 Gene:LIPI HGNCID:18821 Length:481 Species:Homo sapiens

Alignment Length:276 Identity:95/277 (34%)
Similarity:133/277 (48%) Gaps:40/277 (14%)


  Fly    58 IVHGY--LGSCTHGSIMPLRNAYTAQGY---------ENVLVADWGPVANLDYPSSRLAVKNVAQ 111
            ::|||  :||      :||    ..|.:         .||:|.||...|. .:..:| ||||..:
Human   100 LIHGYRPVGS------IPL----WLQNFVRILLNEEDMNVIVVDWSRGAT-TFIYNR-AVKNTRK 152

  Fly   112 ILAKLLEEF--LQRHGISLEGVHVIGHSLGAHIAGRIGRYFNGSLGRVTGLDPALPLFSSRSDDS 174
            :...|....  |.:||.||:..|.||.||||||:|.:|:.|:|.|||:||||||.|.||.:...|
Human   153 VAVSLSVHIKNLLKHGASLDNFHFIGVSLGAHISGFVGKIFHGQLGRITGLDPAGPRFSRKPPYS 217

  Fly   175 -LHSNAAQFVDVIHTDYPLFGDIRPRGTVDFYPNFGLAPQPGCENVDVVAASKLLHEAYSCSHNR 238
             |....|:||||||:|....|...|.|.:|||||.| ..||||.. .:.:..:.:    .|:|.|
Human   218 RLDYTDAKFVDVIHSDSNGLGIQEPLGHIDFYPNGG-NKQPGCPK-SIFSGIQFI----KCNHQR 276

  Fly   239 AVMFYAESIGMPENFPAVSCSLTAIKSRRVE-----DCLREKSKTNT-ENANDYQTVFMGEHVNR 297
            ||..:..|:....||.:..|  .:.|..:..     ||.:|||.... ..|..::.|.......|
Human   277 AVHLFMASLETNCNFISFPC--RSYKDYKTSLCVDCDCFKEKSCPRLGYQAKLFKGVLKERMEGR 339

  Fly   298 SATLYYYLETNGAPPY 313
            ......:|:|:|..|:
Human   340 PLRTTVFLDTSGTYPF 355

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10357NP_647821.2 Pancreat_lipase_like 28..308 CDD:238363 93/270 (34%)
LIPINP_945347.2 Lipase 26..355 CDD:278576 95/275 (35%)
Pancreat_lipase_like 62..330 CDD:238363 89/250 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0.759104 Normalized mean entropy S7741
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11610
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.950

Return to query results.
Submit another query.