DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10357 and Pnliprp2

Sequence 1:NP_647821.2 Gene:CG10357 FlyBaseID:FBgn0035453 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_476554.1 Gene:Pnliprp2 RGDID:620793 Length:482 Species:Rattus norvegicus

Alignment Length:328 Identity:93/329 (28%)
Similarity:141/329 (43%) Gaps:60/329 (18%)


  Fly    45 NVEQLSSVE-------------SVKLIVHGYLGSCTHGSIMPLRNAYTAQGYENVLVADWGPVAN 96
            |.:::|:.|             ..:.||||::.....|.::.:..........|.:..||...:.
  Rat    79 NYQKISATEPDTIKFSNFQLDRKTRFIVHGFIDKGEDGWLLDMCKKMFQVEKVNCICVDWRRGSR 143

  Fly    97 LDYPSSRLAVKNVAQILAKLLEEFLQRHGISLEGVHVIGHSLGAHIAGRIGRYFNGSLGRVTGLD 161
            .:|..:....:.|...:|.|::......|.|.|.||:||||||||:.|..||...|.:||:||||
  Rat   144 TEYTQASYNTRVVGAEIAFLVQVLSTEMGYSPENVHLIGHSLGAHVVGEAGRRLEGHVGRITGLD 208

  Fly   162 PALPLFSSRSDD-SLHSNAAQFVDVIHTD------YPLFGDIRPRGTVDFYPNFGLAPQPGCEN- 218
            ||.|.|....:: .|..:.|.||||||||      |..||..:..|.:||:||.| ...|||:. 
  Rat   209 PAEPCFQGLPEEVRLDPSDAMFVDVIHTDSAPIIPYLGFGMSQKVGHLDFFPNGG-KEMPGCQKN 272

  Fly   219 -----VDVVAASKLLHEAYSCSHNRAVMFYAESIGMPENFPAVSCSLTAIKSRRVEDCL------ 272
                 ||:....:......:|:|.|:..:||.||..|:.|....||  :.:..:..||.      
  Rat   273 ILSTIVDINGIWEGTQNFVACNHLRSYKYYASSILNPDGFLGYPCS--SYEKFQQNDCFPCPEEG 335

  Fly   273 ---------REKSKTNTENANDYQTVFMGEHVNRSATLYYY---LETNGAPP---------YGQG 316
                     :.:.||.|..    |||::....:.:.|.:.|   :..:||..         ||..
  Rat   336 CPKMGHYADQFEGKTATVE----QTVYLNTGDSGNFTRWRYKVSVTLSGAKKLSGYILVALYGNN 396

  Fly   317 RNS 319
            .||
  Rat   397 GNS 399

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10357NP_647821.2 Pancreat_lipase_like 28..308 CDD:238363 87/307 (28%)
Pnliprp2NP_476554.1 Lipase 31..367 CDD:278576 85/295 (29%)
Pancreat_lipase_like 65..363 CDD:238363 85/291 (29%)
PLAT_PL 370..482 CDD:238857 7/31 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11610
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.