DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10357 and pnliprp3

Sequence 1:NP_647821.2 Gene:CG10357 FlyBaseID:FBgn0035453 Length:321 Species:Drosophila melanogaster
Sequence 2:XP_017945500.1 Gene:pnliprp3 XenbaseID:XB-GENE-6250474 Length:453 Species:Xenopus tropicalis

Alignment Length:335 Identity:82/336 (24%)
Similarity:119/336 (35%) Gaps:125/336 (37%)


  Fly    30 STIYYLKPSADVSLENVEQLSSVES--------------VKLIVHGYLGSCTHGSIMPLRNAYTA 80
            :|.|:|     |:.||.:....:.|              .:.|:||::.:...|..|.:..    
 Frog   164 NTRYFL-----VTRENPDYFQEIISHSSVSTSNFKPNRKTRFIIHGFVNTAERGWQMEMCQ---- 219

  Fly    81 QGYENVLVADWGPVANLDYPSSRLAVKNVAQILAKLLEEFLQRHGISLEGVHVIGHSLGAHIAGR 145
                          .|.||..|.                           :|:||||||||:||.
 Frog   220 --------------KNYDYSPSM---------------------------IHIIGHSLGAHVAGE 243

  Fly   146 IGRYFNGSLGRVTGLDPALPLFSSRSDD-SLHSNAAQFVDVIHTD-YPL-----FGDIRPRGTVD 203
            .|:...| :.|::|||||.|||.:...: .|....|.|||.|||| .||     .|..:..|.:|
 Frog   244 AGKRVPG-IARISGLDPAGPLFQNTPPEVRLDPTDADFVDAIHTDTSPLIPKIGLGMAQSVGHLD 307

  Fly   204 FYPNFGLAPQPGCENVDVVAASKLLHEAY-------SCSHNRAVMFYAESIGMPENF-------- 253
            |:||.| ...|||.: :::.....:.|.:       :|:|.|:..:|.|||..|:.|        
 Frog   308 FFPNGG-QTMPGCGS-NIITRLLDIEELWGGADNYLACNHLRSYKYYTESIRTPDAFVAFPSDTY 370

  Fly   254 -----------PAVSCSLTAIKSRRVEDCLREKSKTNTENANDYQTVFMGEHVNRSATLYYYLET 307
                       |:..|.|..                       |...|.|.  ...:.|..||.|
 Frog   371 EAFMKGTGFPCPSTGCPLMG-----------------------YYAGFYGR--GTLSGLPLYLNT 410

  Fly   308 NGAPPYGQGR 317
            ....||.:.|
 Frog   411 GDVSPYARWR 420

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10357NP_647821.2 Pancreat_lipase_like 28..308 CDD:238363 79/325 (24%)
pnliprp3XP_017945500.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.