DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12012 and Bri3

Sequence 1:NP_001286929.1 Gene:CG12012 FlyBaseID:FBgn0035444 Length:122 Species:Drosophila melanogaster
Sequence 2:NP_061242.3 Gene:Bri3 MGIID:1933174 Length:125 Species:Mus musculus

Alignment Length:126 Identity:49/127 (39%)
Similarity:60/127 (47%) Gaps:25/127 (20%)


  Fly    10 PPSYEEVMNSPSQDSRLIVGVH-QGA-PSAPP-----------PNMHMPTYGAFETTPVSVVIQP 61
            ||:|    |..:.......|.| .|| |:|||           |..|...|.....|   |...|
Mouse    11 PPAY----NLEAGQGDYACGPHGYGAIPTAPPPPPYPYLVTGIPTSHPRVYNIHSRT---VTRYP 68

  Fly    62 APVAMPTEIIVIGGCPACRIGYLEDTFSACGLCCAIFFFPLGILCCLAMREKRCSNCGTVF 122
            |     ..|:|:||||.||:|.||..|:..|:..||..||.|.|||.|:|::||.|||.||
Mouse    69 A-----NSIVVVGGCPVCRVGVLEYCFTCLGIFLAIVLFPFGFLCCFALRKRRCPNCGAVF 124

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12012NP_001286929.1 DUF2367 20..122 CDD:287173 44/115 (38%)
Bri3NP_061242.3 DUF2367 29..124 CDD:313402 42/103 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C246738483
eggNOG 1 0.900 E1_KOG4517
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 78 1.000 Inparanoid score I5189
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0006254
OrthoInspector 1 1.000 T1085335
orthoMCL 1 0.900 OOG5_136406
Panther 1 1.100 LDO PTHR13551
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5037
TreeFam 1 0.960
109.870

Return to query results.
Submit another query.