DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12012 and Bri3

Sequence 1:NP_001286929.1 Gene:CG12012 FlyBaseID:FBgn0035444 Length:122 Species:Drosophila melanogaster
Sequence 2:NP_001009604.1 Gene:Bri3 RGDID:1309187 Length:125 Species:Rattus norvegicus

Alignment Length:127 Identity:51/128 (40%)
Similarity:62/128 (48%) Gaps:27/128 (21%)


  Fly    10 PPSYEEVMNSPSQDSRLIVGVH-QGA-PSAPPPNMHMPTYGAFET-TPVS-----------VVIQ 60
            ||:|    |..:.......|.| .|| |:||||    |.|....| .|.|           |...
  Rat    11 PPAY----NLEAGQGDYACGPHGYGAIPTAPPP----PPYPYLVTGIPTSHPRVYNIHSRAVTRY 67

  Fly    61 PAPVAMPTEIIVIGGCPACRIGYLEDTFSACGLCCAIFFFPLGILCCLAMREKRCSNCGTVF 122
            ||     ..|:|:||||.||:|.||..|:..|:..||..||.|.|||.|:|::||.|||.||
  Rat    68 PA-----NSIVVVGGCPVCRVGVLEYCFTCLGIFLAIVLFPFGFLCCFALRKRRCPNCGAVF 124

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12012NP_001286929.1 DUF2367 20..122 CDD:287173 46/116 (40%)
Bri3NP_001009604.1 DUF2367 29..124 CDD:287173 44/104 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C246739799
eggNOG 1 0.900 E1_KOG4517
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 78 1.000 Inparanoid score I5066
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1433992at2759
OrthoFinder 1 1.000 FOG0006254
OrthoInspector 1 1.000 T1088881
orthoMCL 1 0.900 OOG5_136406
Panther 1 1.100 LDO PTHR13551
Phylome 00.000 Not matched by this tool.
TreeFam 1 0.960
109.850

Return to query results.
Submit another query.