DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12012 and BRI3

Sequence 1:NP_001286929.1 Gene:CG12012 FlyBaseID:FBgn0035444 Length:122 Species:Drosophila melanogaster
Sequence 2:XP_016867420.1 Gene:BRI3 HGNCID:1109 Length:155 Species:Homo sapiens

Alignment Length:40 Identity:15/41 (37%)
Similarity:18/41 (44%) Gaps:10/41 (24%)


  Fly    10 PPSYEEVMNSPSQDSRLIVGVH-QGA-PSAPPPNMHMPTY 47
            ||:|    |..:.......|.| .|| |:||||    |.|
Human    11 PPAY----NLEAGQGDYACGPHGYGAIPAAPPP----PPY 42

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12012NP_001286929.1 DUF2367 20..122 CDD:287173 11/31 (35%)
BRI3XP_016867420.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C246740873
eggNOG 1 0.900 E1_KOG4517
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 80 1.000 Inparanoid score I5145
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1433992at2759
OrthoFinder 1 1.000 FOG0006254
OrthoInspector 1 1.000 T1075225
orthoMCL 1 0.900 OOG5_136406
Panther 1 1.100 LDO PTHR13551
Phylome 1 0.910 0.933 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5037
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1211.790

Return to query results.
Submit another query.