DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12012 and BRI3

DIOPT Version :10

Sequence 1:NP_647813.1 Gene:CG12012 / 38422 FlyBaseID:FBgn0035444 Length:122 Species:Drosophila melanogaster
Sequence 2:XP_016867420.1 Gene:BRI3 / 25798 HGNCID:1109 Length:155 Species:Homo sapiens


Alignment Length:40 Identity:15/40 - (37%)
Similarity:18/40 - (45%) Gaps:10/40 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 PPSYEEVMNSPSQDSRLIVGVH-QGA-PSAPPPNMHMPTY 47
            ||:|    |..:.......|.| .|| |:||||    |.|
Human    11 PPAY----NLEAGQGDYACGPHGYGAIPAAPPP----PPY 42

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12012NP_647813.1 BRI3 20..122 CDD:431102 11/30 (37%)
BRI3XP_016867420.1 None

Return to query results.
Submit another query.