DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12012 and BRI3

DIOPT Version :9

Sequence 1:NP_001286929.1 Gene:CG12012 / 38422 FlyBaseID:FBgn0035444 Length:122 Species:Drosophila melanogaster
Sequence 2:XP_016867420.1 Gene:BRI3 / 25798 HGNCID:1109 Length:155 Species:Homo sapiens


Alignment Length:40 Identity:15/40 - (37%)
Similarity:18/40 - (45%) Gaps:10/40 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 PPSYEEVMNSPSQDSRLIVGVH-QGA-PSAPPPNMHMPTY 47
            ||:|    |..:.......|.| .|| |:||||    |.|
Human    11 PPAY----NLEAGQGDYACGPHGYGAIPAAPPP----PPY 42

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12012NP_001286929.1 DUF2367 31..122 CDD:401972 10/19 (53%)
BRI3XP_016867420.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143654
Domainoid 1 1.000 77 1.000 Domainoid score I8941
eggNOG 1 0.900 - - E1_KOG4517
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I5235
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1433992at2759
OrthoFinder 1 1.000 - - FOG0008415
OrthoInspector 1 1.000 - - oto88959
orthoMCL 1 0.900 - - OOG6_108570
Panther 1 1.100 - - LDO PTHR13551
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5037
SonicParanoid 1 1.000 - - X6407
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1413.790

Return to query results.
Submit another query.