powered by:
Protein Alignment CG12012 and T28C6.8
DIOPT Version :9
Sequence 1: | NP_001286929.1 |
Gene: | CG12012 / 38422 |
FlyBaseID: | FBgn0035444 |
Length: | 122 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_501529.1 |
Gene: | T28C6.8 / 177696 |
WormBaseID: | WBGene00012122 |
Length: | 119 |
Species: | Caenorhabditis elegans |
Alignment Length: | 43 |
Identity: | 17/43 - (39%) |
Similarity: | 23/43 - (53%) |
Gaps: | 0/43 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 76 CPACRIGYLEDTFSACGLCCAIFFFPLGILCCLAMREKRCSNC 118
||||....::..||...:..|||.||.||.||:..:...|:.|
Worm 11 CPACTQKKVKSRFSWRAILYAIFCFPCGIYCCMKRKTYYCTQC 53
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG4517 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.810 |
|
Return to query results.
Submit another query.