DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12012 and T28C6.8

DIOPT Version :9

Sequence 1:NP_001286929.1 Gene:CG12012 / 38422 FlyBaseID:FBgn0035444 Length:122 Species:Drosophila melanogaster
Sequence 2:NP_501529.1 Gene:T28C6.8 / 177696 WormBaseID:WBGene00012122 Length:119 Species:Caenorhabditis elegans


Alignment Length:43 Identity:17/43 - (39%)
Similarity:23/43 - (53%) Gaps:0/43 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 CPACRIGYLEDTFSACGLCCAIFFFPLGILCCLAMREKRCSNC 118
            ||||....::..||...:..|||.||.||.||:..:...|:.|
 Worm    11 CPACTQKKVKSRFSWRAILYAIFCFPCGIYCCMKRKTYYCTQC 53

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12012NP_001286929.1 DUF2367 31..122 CDD:401972 17/43 (40%)
T28C6.8NP_501529.1 DUF2367 <11..53 CDD:287173 16/41 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4517
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.