DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12012 and T28C6.8

Sequence 1:NP_001286929.1 Gene:CG12012 FlyBaseID:FBgn0035444 Length:122 Species:Drosophila melanogaster
Sequence 2:NP_501529.1 Gene:T28C6.8 WormBaseID:WBGene00012122 Length:119 Species:Caenorhabditis elegans

Alignment Length:43 Identity:17/44 (39%)
Similarity:23/44 (52%) Gaps:0/44 (0%)


  Fly    76 CPACRIGYLEDTFSACGLCCAIFFFPLGILCCLAMREKRCSNC 118
            ||||....::..||...:..|||.||.||.||:..:...|:.|
 Worm    11 CPACTQKKVKSRFSWRAILYAIFCFPCGIYCCMKRKTYYCTQC 53

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12012NP_001286929.1 DUF2367 20..122 CDD:287173 17/44 (39%)
T28C6.8NP_501529.1 DUF2367 <11..53 CDD:287173 16/42 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG4517
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0006254
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.