DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12012 and F11G11.5

Sequence 1:NP_001286929.1 Gene:CG12012 FlyBaseID:FBgn0035444 Length:122 Species:Drosophila melanogaster
Sequence 2:NP_494874.1 Gene:F11G11.5 WormBaseID:WBGene00017385 Length:223 Species:Caenorhabditis elegans

Alignment Length:132 Identity:39/133 (29%)
Similarity:54/133 (41%) Gaps:23/133 (17%)


  Fly     7 DAAPPSYEEVMNSP-------SQDSRLIVGVHQGAPSA--PPPNM---HMPTYGAFETTPVSVVI 59
            |..||||:..|:.|       |.|.:...|   |.|..  .||.:   .:|...|.|....:|.|
 Worm    91 DMPPPSYQAAMSYPAAPTYGGSTDPKYHNG---GQPPIYYQPPQITQTRLPQPAAIEQIVRAVRI 152

  Fly    60 Q-PAPVAMPTEIIVIGGCPACRIGYLEDTFSACGLCC----AIFFFPLGI--LCCLAMR-EKRCS 116
            | ||...:...:.....|..|.:|.:......|.|.|    .||.||.|:  |||:... :.||:
 Worm   153 QNPAGSNVIVHVQPGAPCRRCTVGVITRQTDMCCLLCLIMLTIFTFPFGLIFLCCVPCTVQNRCT 217

  Fly   117 NC 118
            :|
 Worm   218 HC 219

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12012NP_001286929.1 DUF2367 20..122 CDD:287173 33/120 (28%)
F11G11.5NP_494874.1 DUF2367 120..219 CDD:287173 29/102 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C246737418
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR13551
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.