DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12012 and bri3

Sequence 1:NP_001286929.1 Gene:CG12012 FlyBaseID:FBgn0035444 Length:122 Species:Drosophila melanogaster
Sequence 2:NP_001116284.1 Gene:bri3 XenbaseID:XB-GENE-949087 Length:134 Species:Xenopus tropicalis

Alignment Length:127 Identity:52/128 (41%)
Similarity:72/128 (56%) Gaps:18/128 (14%)


  Fly    10 PPSYEEVMNSPSQDSRLIVGVHQGAPSA-------PPPNMHMPTYG-------AFETTPVSVVIQ 60
            ||:|...:.......:...|...|||..       |||..:.|..|       |:.:| .:::.|
 Frog    11 PPAYSPAVPGGYDYGQQNYGTIPGAPQTAAQPAFQPPPYPYPPGAGFVPPSQPAYPST-YTIIQQ 74

  Fly    61 PAPVAMPTEIIVIGGCPACRIGYLEDTFSACGLCCAIFFFPLGILCCLAMREKRCSNCGTVF 122
            ||..   |.::|:|||||||:|.|||:|:..||.|||||||:|||.|:|:|::||.|||..|
 Frog    75 PAAT---TSVVVVGGCPACRVGVLEDSFTCLGLFCAIFFFPIGILFCMALRQRRCPNCGATF 133

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12012NP_001286929.1 DUF2367 20..122 CDD:287173 48/116 (41%)
bri3NP_001116284.1 DUF2367 28..133 CDD:287173 48/109 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C246739224
eggNOG 1 0.900 E1_KOG4517
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 99 1.000 Inparanoid score I4757
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1433992at2759
OrthoFinder 1 1.000 FOG0006254
OrthoInspector 1 1.000 T1061279
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5037
TreeFam 1 0.960
109.790

Return to query results.
Submit another query.