DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12012 and bri3

Sequence 1:NP_001286929.1 Gene:CG12012 FlyBaseID:FBgn0035444 Length:122 Species:Drosophila melanogaster
Sequence 2:NP_001186968.1 Gene:bri3 ZFINID:ZDB-GENE-030131-3038 Length:130 Species:Danio rerio

Alignment Length:120 Identity:52/121 (43%)
Similarity:68/121 (56%) Gaps:8/121 (7%)


  Fly    10 PPSYEEVMNSPSQDSRLIVGVHQGA--PSAPPPNMHMPTYGA-FETTPVSVVIQPA----PVAMP 67
            ||:|..|.::....|....|.....  |.||||....|...: :...|.....|||    .:..|
Zfish    11 PPAYNTVPSAYDYGSIPAAGAPAAGFQPPAPPPYQGFPAAASGYPAAPAPAAAQPAFSTYTIVQP 75

  Fly    68 TEIIVIGGCPACRIGYLEDTFSACGLCCAIFFFPLGILCCLAMREKRCSNCGTVF 122
            : ::|:|||||||:|.|||.|:..|:.|||||||||||.|||:|::||.|||..|
Zfish    76 S-VVVVGGCPACRVGVLEDDFTCLGIMCAIFFFPLGILFCLALRQRRCPNCGATF 129

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12012NP_001286929.1 DUF2367 20..122 CDD:287173 47/109 (43%)
bri3NP_001186968.1 DUF2367 13..129 CDD:287173 49/117 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C246741355
eggNOG 1 0.900 E1_KOG4517
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 102 1.000 Inparanoid score I4889
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1433992at2759
OrthoFinder 1 1.000 FOG0006254
OrthoInspector 1 1.000 T1054476
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR13551
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5037
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
109.980

Return to query results.
Submit another query.