DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drs and Drsl3

DIOPT Version :10

Sequence 1:NP_523901.1 Gene:Drs / 38419 FlyBaseID:FBgn0283461 Length:70 Species:Drosophila melanogaster
Sequence 2:NP_728861.1 Gene:Drsl3 / 317955 FlyBaseID:FBgn0052283 Length:71 Species:Drosophila melanogaster


Alignment Length:71 Identity:40/71 - (56%)
Similarity:52/71 - (73%) Gaps:1/71 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MMQIKYLFALFAVLMLVVLGANEADA-DCLSGRYKGPCAVWDNETCRRVCKEEGRSSGHCSPSLK 64
            |:|:.:|||:.||:.:|::.||...| |||||.:.|||..|..|.|||:|.|||..|||||.::|
  Fly     1 MVQMIFLFAILAVMTIVLMEANTVLARDCLSGTFGGPCWAWSGEKCRRLCIEEGHVSGHCSGAMK 65

  Fly    65 CWCEGC 70
            ||||||
  Fly    66 CWCEGC 71

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DrsNP_523901.1 Gamma-thionin 27..69 CDD:395240 26/41 (63%)
Drsl3NP_728861.1 Gamma-thionin 28..70 CDD:395240 26/41 (63%)

Return to query results.
Submit another query.