DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drs and Drsl4

DIOPT Version :10

Sequence 1:NP_523901.1 Gene:Drs / 38419 FlyBaseID:FBgn0283461 Length:70 Species:Drosophila melanogaster
Sequence 2:NP_728862.1 Gene:Drsl4 / 317954 FlyBaseID:FBgn0052282 Length:71 Species:Drosophila melanogaster


Alignment Length:71 Identity:47/71 - (66%)
Similarity:54/71 - (76%) Gaps:1/71 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MMQIKYLFALFAVLMLVVLGANEADA-DCLSGRYKGPCAVWDNETCRRVCKEEGRSSGHCSPSLK 64
            |.|||.||||.||:.:|::.||.|.| ||.|||:.|||..||.|.|||:|:||||.|||||.|||
  Fly     1 MAQIKGLFALLAVVTIVLMVANSASAVDCPSGRFSGPCWAWDGEQCRRLCREEGRVSGHCSASLK 65

  Fly    65 CWCEGC 70
            ||||.|
  Fly    66 CWCEQC 71

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DrsNP_523901.1 Gamma-thionin 27..69 CDD:395240 30/41 (73%)
Drsl4NP_728862.1 Gamma-thionin 28..70 CDD:395240 30/41 (73%)

Return to query results.
Submit another query.