powered by:
Protein Alignment: Drsl6 and Drsl1
Sequence 1: | NP_728873.1 |
Gene: | Drsl6 |
FlyBaseID: | FBgn0052268 |
Length: | 72 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_728872.1 |
Gene: | Drsl1 |
FlyBaseID: | FBgn0052274 |
Length: | 69 |
Species: | Drosophila melanogaster |
Alignment Length: | 71 |
Identity: | 43/72 (60%) |
Similarity: | 53/72 (74%) |
Gaps: | 2/72 (3%) |
Fly 2 MQIKFLFTFLALLMMVILGAKEADADCLSGRYRGPCAVWDNETCRRVCREEGRGRVSGHCSARLQ 66
|:||||....|:||::.|||:|:.||||||||||.||||..:.|..:|:.| ||.|||||..|:
Fly 1 MEIKFLIVLSAVLMIIFLGAEESHADCLSGRYRGSCAVWHRKKCVDICQRE--GRTSGHCSPSLK 63
Fly 67 CWCEGC 72
||||||
Fly 64 CWCEGC 69
|
Known Domains:
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
|
|
|
C134646153 |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.930 |
|
Return to query results.
Submit another query.