DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drsl6 and Drsl1

DIOPT Version :9

Sequence 1:NP_728873.1 Gene:Drsl6 / 38416 FlyBaseID:FBgn0052268 Length:72 Species:Drosophila melanogaster
Sequence 2:NP_728872.1 Gene:Drsl1 / 326207 FlyBaseID:FBgn0052274 Length:69 Species:Drosophila melanogaster


Alignment Length:71 Identity:43/71 - (60%)
Similarity:53/71 - (74%) Gaps:2/71 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 MQIKFLFTFLALLMMVILGAKEADADCLSGRYRGPCAVWDNETCRRVCREEGRGRVSGHCSARLQ 66
            |:||||....|:||::.|||:|:.||||||||||.||||..:.|..:|:.|  ||.|||||..|:
  Fly     1 MEIKFLIVLSAVLMIIFLGAEESHADCLSGRYRGSCAVWHRKKCVDICQRE--GRTSGHCSPSLK 63

  Fly    67 CWCEGC 72
            ||||||
  Fly    64 CWCEGC 69

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Drsl6NP_728873.1 Gamma-thionin 27..71 CDD:278720 27/43 (63%)
Drsl1NP_728872.1 Gamma-thionin 24..68 CDD:278720 28/45 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448662
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0008543
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.