DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Drsl6 and Drsl3

Sequence 1:NP_728873.1 Gene:Drsl6 FlyBaseID:FBgn0052268 Length:72 Species:Drosophila melanogaster
Sequence 2:NP_728861.1 Gene:Drsl3 FlyBaseID:FBgn0052283 Length:71 Species:Drosophila melanogaster

Alignment Length:73 Identity:39/74 (53%)
Similarity:50/74 (68%) Gaps:3/74 (4%)


  Fly     1 MMQIKFLFTFLALLMMVILGAKEADA-DCLSGRYRGPCAVWDNETCRRVCREEGRGRVSGHCSAR 64
            |:|:.|||..||::.:|::.|....| |||||.:.|||..|..|.|||:|.||  |.||||||..
  Fly     1 MVQMIFLFAILAVMTIVLMEANTVLARDCLSGTFGGPCWAWSGEKCRRLCIEE--GHVSGHCSGA 63

  Fly    65 LQCWCEGC 72
            ::||||||
  Fly    64 MKCWCEGC 71

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Drsl6NP_728873.1 Gamma-thionin 27..71 CDD:278720 27/44 (61%)
Drsl3NP_728861.1 Gamma-thionin 28..70 CDD:278720 27/44 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C134646195
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.