powered by:
Protein Alignment Drsl6 and Drsl4
DIOPT Version :9
| Sequence 1: | NP_728873.1 |
Gene: | Drsl6 / 38416 |
FlyBaseID: | FBgn0052268 |
Length: | 72 |
Species: | Drosophila melanogaster |
| Sequence 2: | NP_728862.1 |
Gene: | Drsl4 / 317954 |
FlyBaseID: | FBgn0052282 |
Length: | 71 |
Species: | Drosophila melanogaster |
| Alignment Length: | 73 |
Identity: | 45/73 - (61%) |
| Similarity: | 53/73 - (72%) |
Gaps: | 3/73 - (4%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 1 MMQIKFLFTFLALLMMVILGAKEADA-DCLSGRYRGPCAVWDNETCRRVCREEGRGRVSGHCSAR 64
|.|||.||..||::.:|::.|..|.| ||.|||:.|||..||.|.|||:|||| |||||||||.
Fly 1 MAQIKGLFALLAVVTIVLMVANSASAVDCPSGRFSGPCWAWDGEQCRRLCREE--GRVSGHCSAS 63
Fly 65 LQCWCEGC 72
|:||||.|
Fly 64 LKCWCEQC 71
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
| Tool |
Simple Score |
Weighted Score |
Original Tool Information |
| BLAST Result |
Score |
Score Type |
Cluster ID |
| Compara |
1 |
0.930 |
- |
- |
|
C45448677 |
| Domainoid |
0 | 0.000 |
Not matched by this tool. |
| eggNOG |
0 | 0.000 |
Not matched by this tool. |
| Homologene |
0 | 0.000 |
Not matched by this tool. |
| Inparanoid |
0 | 0.000 |
Not matched by this tool. |
| Isobase |
0 | 0.000 |
Not matched by this tool. |
| OMA |
0 | 0.000 |
Not matched by this tool. |
| OrthoDB |
0 | 0.000 |
Not matched by this tool. |
| OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0008543 |
| OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
| orthoMCL |
0 | 0.000 |
Not matched by this tool. |
| Panther |
0 | 0.000 |
Not matched by this tool. |
| Phylome |
1 |
0.910 |
- |
- |
|
|
| RoundUp |
0 | 0.000 |
Not matched by this tool. |
| SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.840 |
|
Return to query results.
Submit another query.