DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14968 and ldlrap1a

DIOPT Version :8

Sequence 1:NP_647800.1 Gene:CG14968 / 38406 FlyBaseID:FBgn0035431 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_945331.1 Gene:ldlrap1a / 368278 ZFINID:ZDB-GENE-030328-13 Length:287 Species:Danio rerio

Alignment Length:187 Identity:49/188 (26%)
Similarity:84/188 (45%) Gaps:20/188 (11%)


  Fly    22 ITFKVKYIGSEVARGLWGIKYTRRPVDIMVGVAKNLPPNKVLPNCELKVSTDGVQL-EIISPKAS 85
            :||.::::|..:.....|.:.:...|..:|..||  ...|.||...||||..|:.| :.:|.:..
Zfish    45 MTFNLRHLGMTLVDQPKGEELSAAAVKRIVATAK--ASGKKLPKVALKVSPQGIILYDSVSNQLI 107

  Fly    86 INHWSYPIDTISYGVQDLVYTRVFAMIVVKDESSPHPFEVHAFVCDSRAMARKLTFALAAAFQ-- 148
            .|   ..|..|||...|..:.:|||.|....::  ...|.|||:|..|.:|:.:|..:|.||:  
Zfish   108 EN---ISIYRISYCTADKTHDKVFAFIAQNQQN--ETLECHAFLCAKRKVAKAVTLTVAQAFRVA 167

  Fly   149 ----DYSRRVK--EATGEEEGEATPSDTITPTRHKFAIDLRTPEEIQAGELEQETEA 199
                :.::..|  ::.||....:....:::.|..|  :.....|.:.  |:|..|.|
Zfish   168 FEFWEVAKDEKKWDSAGETSNSSQSDRSVSLTSLK--VGAAATENLL--EIEDYTSA 220

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14968NP_647800.1 PTB_LDLRAP_insect-like 23..147 CDD:269982 38/125 (30%)
ldlrap1aNP_945331.1 PTB_LDLRAP-mammal-like 43..165 CDD:269981 39/127 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3536
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 47 1.000 Inparanoid score I5392
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.950

Return to query results.
Submit another query.