DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14968 and ldlrap1a

DIOPT Version :9

Sequence 1:NP_647800.1 Gene:CG14968 / 38406 FlyBaseID:FBgn0035431 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_945331.1 Gene:ldlrap1a / 368278 ZFINID:ZDB-GENE-030328-13 Length:287 Species:Danio rerio


Alignment Length:187 Identity:49/187 - (26%)
Similarity:84/187 - (44%) Gaps:20/187 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 ITFKVKYIGSEVARGLWGIKYTRRPVDIMVGVAKNLPPNKVLPNCELKVSTDGVQL-EIISPKAS 85
            :||.::::|..:.....|.:.:...|..:|..||  ...|.||...||||..|:.| :.:|.:..
Zfish    45 MTFNLRHLGMTLVDQPKGEELSAAAVKRIVATAK--ASGKKLPKVALKVSPQGIILYDSVSNQLI 107

  Fly    86 INHWSYPIDTISYGVQDLVYTRVFAMIVVKDESSPHPFEVHAFVCDSRAMARKLTFALAAAFQ-- 148
            .|   ..|..|||...|..:.:|||.|....::  ...|.|||:|..|.:|:.:|..:|.||:  
Zfish   108 EN---ISIYRISYCTADKTHDKVFAFIAQNQQN--ETLECHAFLCAKRKVAKAVTLTVAQAFRVA 167

  Fly   149 ----DYSRRVK--EATGEEEGEATPSDTITPTRHKFAIDLRTPEEIQAGELEQETEA 199
                :.::..|  ::.||....:....:::.|..|  :.....|.:.  |:|..|.|
Zfish   168 FEFWEVAKDEKKWDSAGETSNSSQSDRSVSLTSLK--VGAAATENLL--EIEDYTSA 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14968NP_647800.1 PTB_LDLRAP_insect-like 23..147 CDD:269982 37/124 (30%)
ldlrap1aNP_945331.1 PTB_LDLRAP-mammal-like 43..165 CDD:269981 38/126 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3536
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.