DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14966 and RGD1305713

DIOPT Version :8

Sequence 1:NP_647784.1 Gene:CG14966 / 38390 FlyBaseID:FBgn0035415 Length:140 Species:Drosophila melanogaster
Sequence 2:XP_006229491.1 Gene:RGD1305713 / 293059 RGDID:1305713 Length:181 Species:Rattus norvegicus

Alignment Length:114 Identity:58/115 (50%)
Similarity:75/115 (65%) Gaps:3/115 (3%)


  Fly    28 KNDAK--AMPAKEASPISVDKSGNICIQILAKPGAKQNGITGIGFEGVGVQIAAPPSEGEANAEL 90
            ||..|  ..|.....|::.|..|.:.|.|.||||:|||.:|.:..|.|||.||||||||||||||
  Rat    67 KNQTKEPETPPPPTGPVATDSKGFVTIAIHAKPGSKQNAVTDLNTEAVGVAIAAPPSEGEANAEL 131

  Fly    91 VKFLSKVLGLRKSDVSLDKGSRSRNKIIMITKGVSTVEAIEQLLRKESD 139
            .::|||||.||||||.||||.:||.|::.:....:..|.:|: ||.|::
  Rat   132 CRYLSKVLDLRKSDVVLDKGGKSREKVVKLLASTTPEEVLEK-LRTEAE 179

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14966NP_647784.1 DUF167 52..120 CDD:280714 46/68 (68%)
RGD1305713XP_006229491.1 DUF167 93..161 CDD:280714 46/68 (68%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H12109
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0004976
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR13420
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.110

Return to query results.
Submit another query.