DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14966 and W01A8.2

DIOPT Version :9

Sequence 1:NP_647784.1 Gene:CG14966 / 38390 FlyBaseID:FBgn0035415 Length:140 Species:Drosophila melanogaster
Sequence 2:NP_001379463.1 Gene:W01A8.2 / 172436 WormBaseID:WBGene00012164 Length:127 Species:Caenorhabditis elegans


Alignment Length:111 Identity:45/111 - (40%)
Similarity:68/111 - (61%) Gaps:4/111 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 DAKAMPAKEASPISVDKSGNICIQILAKPGAKQNGITGIGFEGVGVQIAAPPSEGEANAELVKFL 94
            |.||    :.|.|..|..|.|.:.|.||||||::.:..||...|.|.|.|.|.||.||.||:.:|
 Worm    21 DKKA----QESAIFSDTEGRIGLHIHAKPGAKKSCVVAIGDSEVDVAIGAAPREGAANEELISYL 81

  Fly    95 SKVLGLRKSDVSLDKGSRSRNKIIMITKGVSTVEAIEQLLRKESDS 140
            ...|||||:::..|||::||:|:::|.....|::.:.:.|::|.|:
 Worm    82 MSALGLRKNELQFDKGAKSRSKVVLIDTKRLTIDEVRKKLQEEIDN 127

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14966NP_647784.1 DUF167 52..120 CDD:280714 32/67 (48%)
W01A8.2NP_001379463.1 DUF167 39..108 CDD:396929 32/68 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160158667
Domainoid 1 1.000 71 1.000 Domainoid score I6163
eggNOG 1 0.900 - - E1_KOG3276
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 84 1.000 Inparanoid score I3749
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005031
OrthoInspector 1 1.000 - - oto20775
orthoMCL 1 0.900 - - OOG6_102805
Panther 1 1.100 - - LDO PTHR13420
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3648
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.780

Return to query results.
Submit another query.