DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14966 and W01A8.2

DIOPT Version :8

Sequence 1:NP_647784.1 Gene:CG14966 / 38390 FlyBaseID:FBgn0035415 Length:140 Species:Drosophila melanogaster
Sequence 2:NP_001076616.1 Gene:W01A8.2 / 172436 WormBaseID:WBGene00012164 Length:127 Species:Caenorhabditis elegans

Alignment Length:111 Identity:45/111 - (40%)
Similarity:68/111 - (61%) Gaps:4/111 - (3%)


  Fly    30 DAKAMPAKEASPISVDKSGNICIQILAKPGAKQNGITGIGFEGVGVQIAAPPSEGEANAELVKFL 94
            |.||    :.|.|..|..|.|.:.|.||||||::.:..||...|.|.|.|.|.||.||.||:.:|
 Worm    21 DKKA----QESAIFSDTEGRIGLHIHAKPGAKKSCVVAIGDSEVDVAIGAAPREGAANEELISYL 81

  Fly    95 SKVLGLRKSDVSLDKGSRSRNKIIMITKGVSTVEAIEQLLRKESDS 140
            ...|||||:::..|||::||:|:::|.....|::.:.:.|::|.|:
 Worm    82 MSALGLRKNELQFDKGAKSRSKVVLIDTKRLTIDEVRKKLQEEIDN 127

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14966NP_647784.1 DUF167 52..120 CDD:280714 32/67 (48%)
W01A8.2NP_001076616.1 DUF167 39..107 CDD:280714 32/67 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C153448998
eggNOG 1 0.900 E1_KOG3276
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 84 1.000 Inparanoid score I3712
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0004976
OrthoInspector 1 1.000 T476470
orthoMCL 1 0.900 OOG5_129681
Panther 1 1.100 LDO PTHR13420
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3648
TreeFam 1 0.960
1211.790

Return to query results.
Submit another query.