DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14966 and C15orf40

DIOPT Version :8

Sequence 1:NP_647784.1 Gene:CG14966 / 38390 FlyBaseID:FBgn0035415 Length:140 Species:Drosophila melanogaster
Sequence 2:XP_011519514.1 Gene:C15orf40 / 123207 HGNCID:28443 Length:194 Species:Homo sapiens

Alignment Length:97 Identity:51/98 (52%)
Similarity:63/98 (64%) Gaps:2/98 (2%)


  Fly    13 MSKSKGKSKAGVESAKNDAKAMPAKEASPISVDKSGNICIQILAKPGAKQNGITGIGFEGVGVQI 77
            |.|..|.:..|...:|...:.:|  ...|::||..|.:.|.|.||||:|||.:|.:..|.|.|.|
Human    28 MPKKAGATTKGKSQSKEPERPLP--PLGPVAVDPKGCVTIAIHAKPGSKQNAVTDLTAEAVNVAI 90

  Fly    78 AAPPSEGEANAELVKFLSKVLGLRKSDVSLDK 109
            |||||||||||||.::|||||.||||||.|||
Human    91 AAPPSEGEANAELCRYLSKVLELRKSDVVLDK 122

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14966NP_647784.1 DUF167 52..120 CDD:280714 41/59 (69%)
C15orf40XP_011519514.1 DUF167 65..122 CDD:280714 40/57 (70%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3276
Hieranoid 1 1.000
Homologene 1 1.000 H12109
Inparanoid 1 1.050 111 1.000 Inparanoid score I4805
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1546648at2759
OrthoFinder 1 1.000 FOG0004976
OrthoInspector 1 1.000 T1075227
orthoMCL 1 0.900 OOG5_129681
Panther 1 1.100 LDO PTHR13420
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3648
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1211.860

Return to query results.
Submit another query.