DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hsp83 and HSP82

Sequence 1:NP_001261362.1 Gene:Hsp83 FlyBaseID:FBgn0001233 Length:717 Species:Drosophila melanogaster
Sequence 2:NP_015084.1 Gene:HSP82 SGDID:S000006161 Length:709 Species:Saccharomyces cerevisiae

Alignment Length:718 Identity:440/719 (61%)
Similarity:562/719 (78%) Gaps:16/719 (2%)


  Fly     5 AETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNASDALDKIRYESLTDPSKLDSGKELYIKLI 69
            :|||.|||||.|||||||||.||||||||||||||||||||||||:||:||.:|::..:|:|::.
Yeast     3 SETFEFQAEITQLMSLIINTVYSNKEIFLRELISNASDALDKIRYKSLSDPKQLETEPDLFIRIT 67

  Fly    70 PNKTAGTLTIIDTGIGMTKSDLVNNLGTIAKSGTKAFMEALQAGADISMIGQFGVGFYSAYLVAD 134
            |......|.|.|:||||||::|:||||||||||||||||||.||||:||||||||||||.:||||
Yeast    68 PKPEQKVLEIRDSGIGMTKAELINNLGTIAKSGTKAFMEALSAGADVSMIGQFGVGFYSLFLVAD 132

  Fly   135 KVTVTSKNNDDEQYVWESSAGGSFTVRADN-SEPLGRGTKIVLYIKEDQTDYLEESKIKEIVNKH 198
            :|.|.||:||||||:|||:|||||||..|. :|.:||||.:.|::|:||.:||||.:|||::.:|
Yeast   133 RVQVISKSNDDEQYIWESNAGGSFTVTLDEVNERIGRGTILRLFLKDDQLEYLEEKRIKEVIKRH 197

  Fly   199 SQFIGYPIKLLVEKEREKEV--SDDEADDEKKEGDEKKEMETDEPKIEDVGEDEDADKKDKDAKK 261
            |:|:.|||:|:|.||.||||  .::|..||:|:.:|||:.:..:||:|:|  ||:.:||    .|
Yeast   198 SEFVAYPIQLVVTKEVEKEVPIPEEEKKDEEKKDEEKKDEDDKKPKLEEV--DEEEEKK----PK 256

  Fly   262 KKTIKEKYTEDEELNKTKPIWTRNPDDISQEEYGEFYKSLTNDWEDHLAVKHFSVEGQLEFRALL 326
            .|.:||:..|.||||||||:|||||.||:||||..||||::|||||.|.||||||||||||||:|
Yeast   257 TKKVKEEVQEIEELNKTKPLWTRNPSDITQEEYNAFYKSISNDWEDPLYVKHFSVEGQLEFRAIL 321

  Fly   327 FIPRRTPFDLFENQKKRNNIKLYVRRVFIMDNCEDLIPEYLNFMKGVVDSEDLPLNISREMLQQN 391
            |||:|.||||||::||:||||||||||||.|..||||||:|:|:||||||||||||:||||||||
Yeast   322 FIPKRAPFDLFESKKKKNNIKLYVRRVFITDEAEDLIPEWLSFVKGVVDSEDLPLNLSREMLQQN 386

  Fly   392 KVLKVIRKNLVKKTMELIEELTEDKENYKKFYDQFSKNLKLGVHEDSNNRAKLADFLRFHTSASG 456
            |::||||||:|||.:|...|:.||.|.::|||..||||:|||||||:.|||.||..||::::.|.
Yeast   387 KIMKVIRKNIVKKLIEAFNEIAEDSEQFEKFYSAFSKNIKLGVHEDTQNRAALAKLLRYNSTKSV 451

  Fly   457 DDFCSLADYVSRMKDNQKHVYFITGESKDQVSNSAFVERVKARGFEVVYMTEPIDEYVIQHLKEY 521
            |:..||.|||:||.::||::|:|||||...|..|.|::.:||:.|||:::|:|||||....|||:
Yeast   452 DELTSLTDYVTRMPEHQKNIYYITGESLKAVEKSPFLDALKAKNFEVLFLTDPIDEYAFTQLKEF 516

  Fly   522 KGKQLVSVTKEGLELPEDESEKKKREEDKAKFESLCKLMKSILDNKVEKVVVSNRLVDSPCCIVT 586
            :||.||.:||: .||.|.:.||.:||::..::|.|.|.:|.||.::|||||||.:|:|:|..|.|
Yeast   517 EGKTLVDITKD-FELEETDEEKAEREKEIKEYEPLTKALKEILGDQVEKVVVSYKLLDAPAAIRT 580

  Fly   587 SQFGWSANMERIMKAQALRDTATMGYMAGKKQLEINPDHPIVETLRQKAD-ADKNDKAVKDLVIL 650
            .|||||||||||||||||||::...||:.||..||:|..||::.|:::.| ....||.||||..|
Yeast   581 GQFGWSANMERIMKAQALRDSSMSSYMSSKKTFEISPKSPIIKELKKRVDEGGAQDKTVKDLTKL 645

  Fly   651 LFETSLLSSGFSLDSPQVHASRIYRMIKLGLGIDEDEPM-TTDDAQSAGDAPSLVEDTEDASHME 714
            |:||:||:||||||.|...||||.|:|.|||.|||||.. |..:|.:|.....:..|||    ||
Yeast   646 LYETALLTSGFSLDEPTSFASRINRLISLGLNIDEDEETETAPEASTAAPVEEVPADTE----ME 706

  Fly   715 EVD 717
            |||
Yeast   707 EVD 709

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Hsp83NP_001261362.1 PTZ00272 6..717 CDD:240341 439/716 (61%)
HATPase_c 28..179 CDD:214643 105/152 (69%)
HSP90 184..706 CDD:278607 305/526 (58%)
HSP82NP_015084.1 HSP90 3..709 CDD:332554 439/717 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C71924463
eggNOG 1 0.900 E1_COG0326
Hieranoid 1 1.000
Homologene 1 1.000 H74306
Inparanoid 1 1.050 861 1.000 Inparanoid score I48
Isobase 1 0.950 0 Normalized mean entropy S263
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000421
OrthoInspector 1 1.000 T634510
orthoMCL 1 0.900 OOG5_126623
Panther 1 1.100 LDO PTHR11528
Phylome 1 0.910 0.933 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R576
TreeFam 1 0.960
1413.740

Return to query results.
Submit another query.