DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hsp83 and Hsp81.4

Sequence 1:NP_001261362.1 Gene:Hsp83 FlyBaseID:FBgn0001233 Length:717 Species:Drosophila melanogaster
Sequence 2:NP_200411.1 Gene:Hsp81.4 AraportID:AT5G56000 Length:699 Species:Arabidopsis thaliana

Alignment Length:716 Identity:474/717 (66%)
Similarity:593/717 (83%) Gaps:21/717 (3%)


  Fly     4 EAETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNASDALDKIRYESLTDPSKLDSGKELYIKL 68
            :||||||||||.||:|||||||||||||||||||||:||||||||:|||||.||||...||:|.:
plant     3 DAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDGQPELFIHI 67

  Fly    69 IPNKTAGTLTIIDTGIGMTKSDLVNNLGTIAKSGTKAFMEALQAGADISMIGQFGVGFYSAYLVA 133
            ||:||..||||||:||||||:||||||||||:||||.|||||.||||:|||||||||||||||||
plant    68 IPDKTNNTLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQFGVGFYSAYLVA 132

  Fly   134 DKVTVTSKNNDDEQYVWESSAGGSFTVRADNS-EPLGRGTKIVLYIKEDQTDYLEESKIKEIVNK 197
            |||.||:|:||||||||||.|||||||..|.| |.||||||::||:||||.:|:||.::|::|.|
plant   133 DKVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGEALGRGTKMILYLKEDQMEYIEERRLKDLVKK 197

  Fly   198 HSQFIGYPIKLLVEKEREKEVSDDEADDEKKEGDEKKEMETDEPKIEDVGEDEDADKKDKDAKKK 262
            ||:||.|||.|.:||..|||:||||.::|||:         :|.|:|::.|:     |:|:.|||
plant   198 HSEFISYPISLWIEKTIEKEISDDEEEEEKKD---------EEGKVEEIDEE-----KEKEEKKK 248

  Fly   263 KTIKEKYTEDEELNKTKPIWTRNPDDISQEEYGEFYKSLTNDWEDHLAVKHFSVEGQLEFRALLF 327
            |.|||...|.:.:||.||||.|.|::|::|||..|||||:||||:|||||||||||||||:|:||
plant   249 KKIKEVTHEWDLVNKQKPIWMRKPEEINKEEYAAFYKSLSNDWEEHLAVKHFSVEGQLEFKAILF 313

  Fly   328 IPRRTPFDLFENQKKRNNIKLYVRRVFIMDNCEDLIPEYLNFMKGVVDSEDLPLNISREMLQQNK 392
            :|:|.|||||:.:||.||||||||||||||||||:||:||.|:||:|||||||||||||.|||||
plant   314 VPKRAPFDLFDTKKKPNNIKLYVRRVFIMDNCEDIIPDYLGFVKGIVDSEDLPLNISRETLQQNK 378

  Fly   393 VLKVIRKNLVKKTMELIEELTEDKENYKKFYDQFSKNLKLGVHEDSNNRAKLADFLRFHTSASGD 457
            :|||||||||||.:||..|:.|:||:|.|||:.||||||||:||||.||.|:|:.||:|::.|||
plant   379 ILKVIRKNLVKKCLELFFEIAENKEDYNKFYEAFSKNLKLGIHEDSQNRTKIAELLRYHSTKSGD 443

  Fly   458 DFCSLADYVSRMKDNQKHVYFITGESKDQVSNSAFVERVKARGFEVVYMTEPIDEYVIQHLKEYK 522
            :..||.|||:|||:.|..:::||||||..|.||.|:|::|.:|:||:||.:.||||.|..|||::
plant   444 ELTSLKDYVTRMKEGQNEIFYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYAIGQLKEFE 508

  Fly   523 GKQLVSVTKEGLELPEDESEKKKREEDKAKFESLCKLMKSILDNKVEKVVVSNRLVDSPCCIVTS 587
            ||:|||.|||||:|.|.:.||||:||.|.|||.|||::|.:|.:|||||:||:|:||||||:||.
plant   509 GKKLVSATKEGLKLEETDDEKKKKEELKEKFEGLCKVIKDVLGDKVEKVIVSDRVVDSPCCLVTG 573

  Fly   588 QFGWSANMERIMKAQALRDTATMGYMAGKKQLEINPDHPIVETLRQKADADKNDKAVKDLVILLF 652
            ::||:||||||||||||:|:.|.|||:.||.:||||::.|::.||::|:||||||:|||||:|||
plant   574 EYGWTANMERIMKAQALKDSNTGGYMSSKKTMEINPENSIMDELRKRAEADKNDKSVKDLVLLLF 638

  Fly   653 ETSLLSSGFSLDSPQVHASRIYRMIKLGLGIDEDEPMTTDDAQSAGDAPSLVEDTE-DASHMEEV 716
            ||:||:||||||.|....|||:||:||||.|:||:.:..|     .:.|.|.:|.: :.|.||||
plant   639 ETALLTSGFSLDEPNTFGSRIHRMLKLGLSIEEDDAVEAD-----AEMPPLEDDADAEGSKMEEV 698

  Fly   717 D 717
            |
plant   699 D 699

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Hsp83NP_001261362.1 PTZ00272 6..717 CDD:240341 472/713 (66%)
HATPase_c 28..179 CDD:214643 122/152 (80%)
HSP90 184..706 CDD:278607 320/522 (61%)
Hsp81.4NP_200411.1 PTZ00272 5..699 CDD:240341 472/713 (66%)
HATPase_c 27..179 CDD:214643 122/152 (80%)
HSP90 184..687 CDD:278607 320/522 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 978 1.000 Inparanoid score I46
OMA 1 1.010
OrthoDB 1 1.010 D924636at2759
OrthoInspector 1 1.000 T125171
orthoMCL 1 0.900 OOG5_126623
Panther 1 1.100 O PTHR11528
Phylome 1 0.910 0.933 Consistency score
87.980

Return to query results.
Submit another query.