DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hsp83 and HSP90.1

Sequence 1:NP_001261362.1 Gene:Hsp83 FlyBaseID:FBgn0001233 Length:717 Species:Drosophila melanogaster
Sequence 2:NP_200076.2 Gene:HSP90.1 AraportID:AT5G52640 Length:700 Species:Arabidopsis thaliana

Alignment Length:717 Identity:492/718 (69%)
Similarity:593/718 (83%) Gaps:22/718 (3%)


  Fly     4 EAETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNASDALDKIRYESLTDPSKLDSGKELYIKL 68
            :||||||||||.||:|||||||||||||||||||||:||||||||:|||||.||||...||:|:|
plant     3 DAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDGQPELFIRL 67

  Fly    69 IPNKTAGTLTIIDTGIGMTKSDLVNNLGTIAKSGTKAFMEALQAGADISMIGQFGVGFYSAYLVA 133
            :|:|:..||:|||:||||||:||||||||||:||||.||||||||||:|||||||||||||||||
plant    68 VPDKSNKTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQFGVGFYSAYLVA 132

  Fly   134 DKVTVTSKNNDDEQYVWESSAGGSFTVRAD-NSEPLGRGTKIVLYIKEDQTDYLEESKIKEIVNK 197
            :||.||:|:||||||||||.|||||||..| :.|||||||||.|::|:||.:||||.::|::|.|
plant   133 EKVVVTTKHNDDEQYVWESQAGGSFTVTRDVDGEPLGRGTKITLFLKDDQLEYLEERRLKDLVKK 197

  Fly   198 HSQFIGYPIKLLVEKEREKEVSDDEADDEKKEGDEKKEMETDEPKIEDVGEDEDAD-KKDKDAKK 261
            ||:||.|||.|..||..|||:||||        ||      ||||.|:.||.|:.| :|:||.||
plant   198 HSEFISYPIYLWTEKTTEKEISDDE--------DE------DEPKKENEGEVEEVDEEKEKDGKK 248

  Fly   262 KKTIKEKYTEDEELNKTKPIWTRNPDDISQEEYGEFYKSLTNDWEDHLAVKHFSVEGQLEFRALL 326
            ||.|||...|.|.:||.||||.|.|::|::|||..||||||||||||||||||||||||||:|:|
plant   249 KKKIKEVSHEWELINKQKPIWLRKPEEITKEEYAAFYKSLTNDWEDHLAVKHFSVEGQLEFKAIL 313

  Fly   327 FIPRRTPFDLFENQKKRNNIKLYVRRVFIMDNCEDLIPEYLNFMKGVVDSEDLPLNISREMLQQN 391
            |:|:|.|||||:.:||.|||||||||||||||||:||||||:|:||||||:|||||||||.||||
plant   314 FVPKRAPFDLFDTRKKLNNIKLYVRRVFIMDNCEELIPEYLSFVKGVVDSDDLPLNISRETLQQN 378

  Fly   392 KVLKVIRKNLVKKTMELIEELTEDKENYKKFYDQFSKNLKLGVHEDSNNRAKLADFLRFHTSASG 456
            |:|||||||||||.:|:..|:.|:||:|.|||:.||||||||:||||.||.|:||.||:|::.||
plant   379 KILKVIRKNLVKKCIEMFNEIAENKEDYTKFYEAFSKNLKLGIHEDSQNRGKIADLLRYHSTKSG 443

  Fly   457 DDFCSLADYVSRMKDNQKHVYFITGESKDQVSNSAFVERVKARGFEVVYMTEPIDEYVIQHLKEY 521
            |:..|..|||:|||:.||.:::||||||..|.||.|:||:|.||:||:||.:.||||.:..||||
plant   444 DEMTSFKDYVTRMKEGQKDIFYITGESKKAVENSPFLERLKKRGYEVLYMVDAIDEYAVGQLKEY 508

  Fly   522 KGKQLVSVTKEGLEL-PEDESEKKKREEDKAKFESLCKLMKSILDNKVEKVVVSNRLVDSPCCIV 585
            .||:|||.|||||:| .|.|.|||||||.|..||:|||.:|.||.:||||||||:|:||||||:|
plant   509 DGKKLVSATKEGLKLEDETEEEKKKREEKKKSFENLCKTIKEILGDKVEKVVVSDRIVDSPCCLV 573

  Fly   586 TSQFGWSANMERIMKAQALRDTATMGYMAGKKQLEINPDHPIVETLRQKADADKNDKAVKDLVIL 650
            |.::||:||||||||||||||::..|||:.||.:|||||:.|:|.||::|:||||||:|||||:|
plant   574 TGEYGWTANMERIMKAQALRDSSMSGYMSSKKTMEINPDNGIMEELRKRAEADKNDKSVKDLVML 638

  Fly   651 LFETSLLSSGFSLDSPQVHASRIYRMIKLGLGIDEDEPMTTDDAQSAGDAPSLVEDTEDASHMEE 715
            |:||:||:||||||.|...|:||:||:||||.|||||.:..|     ||.|.|.||..:.|.|||
plant   639 LYETALLTSGFSLDEPNTFAARIHRMLKLGLSIDEDENVEED-----GDMPELEEDAAEESKMEE 698

  Fly   716 VD 717
            ||
plant   699 VD 700

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Hsp83NP_001261362.1 PTZ00272 6..717 CDD:240341 490/714 (69%)
HATPase_c 28..179 CDD:214643 120/152 (79%)
HSP90 184..706 CDD:278607 341/524 (65%)
HSP90.1NP_200076.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 1 1.000 H74306
Inparanoid 1 1.050 978 1.000 Inparanoid score I46
OMA 1 1.010
OrthoDB 1 1.010 D924636at2759
OrthoInspector 1 1.000 T125171
orthoMCL 1 0.900 OOG5_126623
Panther 1 1.100 O PTHR11528
Phylome 1 0.910 0.933 Consistency score
98.980

Return to query results.
Submit another query.