DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hsp83 and SHD

Sequence 1:NP_001261362.1 Gene:Hsp83 FlyBaseID:FBgn0001233 Length:717 Species:Drosophila melanogaster
Sequence 2:NP_194150.1 Gene:SHD AraportID:AT4G24190 Length:823 Species:Arabidopsis thaliana

Alignment Length:741 Identity:354/742 (48%)
Similarity:500/742 (67%) Gaps:52/742 (7%)


  Fly     5 AETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNASDALDKIRYESLTDPSKLDSGK----ELY 65
            ||.|.||||:::||.:|||:.||||:||||||||||||||||||:.:|||...|..|.    |:.
plant    76 AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLALTDKDVLGEGDTAKLEIQ 140

  Fly    66 IKLIPNKTAGTLTIIDTGIGMTKSDLVNNLGTIAKSGTKAFMEALQAGADISMIGQFGVGFYSAY 130
            |||  :|....|:|.|.||||||.||:.||||||||||.||:|.:|:..|:::||||||||||||
plant   141 IKL--DKAKKILSIRDRGIGMTKEDLIKNLGTIAKSGTSAFVEKMQSSGDLNLIGQFGVGFYSAY 203

  Fly   131 LVADKVTVTSKNNDDEQYVWESSAGGSFTVRADN-SEPLGRGTKIVLYIKEDQTDYLEESKIKEI 194
            ||||.:.|.||:|||.||||||.|.|.|.|..|. :|||||||:|.|:::::..:||||||:||:
plant   204 LVADYIEVISKHNDDSQYVWESKANGKFAVSEDTWNEPLGRGTEIRLHLRDEAGEYLEESKLKEL 268

  Fly   195 VNKHSQFIGYPIKLLVEKEREKE--VSDDEADDEKKEGDEKKEMETDEPKIEDVGEDEDADKKDK 257
            |.::|:||.:||.|...||.|.|  |.:||:.||     |.:...|:|.|.|| .|:||.:||.|
plant   269 VKRYSEFINFPISLWASKEVETEVPVEEDESADE-----ETETTSTEEEKEED-AEEEDGEKKQK 327

  Fly   258 DAKKKKTIKEKYTEDEELNKTKPIWTRNPDDISQEEYGEFYKSLTNDWEDH--LAVKHFSVEGQL 320
            ..|.|:|:.|.    |.||..|.||.|:|.::::|||.:||.||:.|:.|.  :|..||:.||.:
plant   328 TKKVKETVYEW----ELLNDVKAIWLRSPKEVTEEEYTKFYHSLSKDFTDEKPMAWSHFNAEGDV 388

  Fly   321 EFRALLFIPRRTPFDLFENQKKRN--NIKLYVRRVFIMDNCEDLIPEYLNFMKGVVDSEDLPLNI 383
            ||:|:|::|.:.|.||:|:....|  |:|||||||||.|..::|:|:||:|:||:|||:.||||:
plant   389 EFKAVLYVPPKAPHDLYESYYNSNKANLKLYVRRVFISDEFDELLPKYLSFLKGLVDSDTLPLNV 453

  Fly   384 SREMLQQNKVLKVIRKNLVKKTMELIEELTED----------------------KENYKKFYDQF 426
            |||||||:..||.|:|.|::|.:::|.:|.|:                      |..|.||:::|
plant   454 SREMLQQHSSLKTIKKKLIRKALDMIRKLAEEDPDEIHDDEKKDVEKSGENDEKKGQYTKFWNEF 518

  Fly   427 SKNLKLGVHEDSNNRAKLADFLRFHTSASGDDFCSLADYVSRMKDNQKHVYFITGESKDQVSNSA 491
            .|::|||:.||:.||.:||..|||.|:.|.....||..|:.|||.:||.:::|||.||:|:..|.
plant   519 GKSVKLGIIEDAANRNRLAKLLRFETTKSDGKLTSLDQYIKRMKKSQKDIFYITGSSKEQLEKSP 583

  Fly   492 FVERVKARGFEVVYMTEPIDEYVIQHLKEYKGKQLVSVTKEGLELPEDESEKKKREEDKAKFESL 556
            |:||:..:|:||::.|:|:|||::|:|.:|:.|:..:|:||||::.:|..:|:.:|    .|:.|
plant   584 FLERLIKKGYEVIFFTDPVDEYLMQYLMDYEDKKFQNVSKEGLKVGKDSKDKELKE----AFKEL 644

  Fly   557 CKLMK-SILDNKVEKVVVSNRLVDSPCCIVTSQFGWSANMERIMKAQALRDTATMGYMAGKKQLE 620
            .|..| ::....|:.|.:||||.|:||.:|||:|||||||||||::|.|.|.....||.||:.||
plant   645 TKWWKGNLASENVDDVKISNRLADTPCVVVTSKFGWSANMERIMQSQTLSDANKQAYMRGKRVLE 709

  Fly   621 INPDHPIVETLRQKADADKNDKAVKDLVILLFETSLLSSGFSLDSPQVHASRIYRMIKLGLGIDE 685
            |||.|||::.|:.:..:|..|::||:...|:::|:|:.|||.|..|:..|:|||..:|.||.|..
plant   710 INPRHPIIKELKDRIASDPEDESVKETAQLMYQTALIESGFILTDPKDFAARIYNSVKSGLNISP 774

  Fly   686 DEPMTTDDAQSAGDAPSLVEDTEDAS 711
            |  ...|:...|.:.|...|.||..|
plant   775 D--AVADEEIEAAEEPETSEATETKS 798

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Hsp83NP_001261362.1 PTZ00272 6..717 CDD:240341 353/741 (48%)
HATPase_c 28..179 CDD:214643 98/156 (63%)
HSP90 184..706 CDD:278607 239/551 (43%)
SHDNP_194150.1 PRK05218 74..763 CDD:235366 341/703 (49%)
HATPase_c 104..253 CDD:280651 94/151 (62%)
HSP90 258..775 CDD:278607 234/531 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D924636at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126623
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.