DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hsp83 and Hsp89.1

Sequence 1:NP_001261362.1 Gene:Hsp83 FlyBaseID:FBgn0001233 Length:717 Species:Drosophila melanogaster
Sequence 2:NP_001319498.1 Gene:Hsp89.1 AraportID:AT3G07770 Length:799 Species:Arabidopsis thaliana

Alignment Length:730 Identity:315/731 (43%)
Similarity:475/731 (65%) Gaps:40/731 (5%)


  Fly     2 PEEAETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNASDALDKIRYESLTDPSKLDSGKELYI 66
            |..||.|.:|||:::||.||:|:.|||||:|||||||||||||||:||.|:|:|.......:|.|
plant    91 PPPAEKFEYQAEVSRLMDLIVNSLYSNKEVFLRELISNASDALDKLRYLSVTNPELSKDAPDLDI 155

  Fly    67 KLIPNKTAGTLTIIDTGIGMTKSDLVNNLGTIAKSGTKAFMEALQ----AGADISMIGQFGVGFY 127
            ::..:|..|.:|:.|:|||||:.:||:.|||||:|||..||:||:    ||.|.::|||||||||
plant   156 RIYADKENGIITLTDSGIGMTRQELVDCLGTIAQSGTAKFMKALKDSKDAGGDNNLIGQFGVGFY 220

  Fly   128 SAYLVADKVTVTSKN-NDDEQYVWESSA-GGSFTVRADNSEP---LGRGTKIVLYIKEDQTDYLE 187
            ||:||||:|.|::|: ..|:|||||..| ..|||::.| ::|   :.|||:|.|::|::..::.:
plant   221 SAFLVADRVIVSTKSPKSDKQYVWEGEANSSSFTIQED-TDPQSLIPRGTRITLHLKQEAKNFAD 284

  Fly   188 ESKIKEIVNKHSQFIGYPIKLLVEKEREKEVSDDEADDEKKEGDEKKEMETDEPKIEDVGEDEDA 252
            ..:|:::|..:|||:.:||....||...|||..::...|.|:.|                :|:..
plant   285 PERIQKLVKNYSQFVSFPIYTWQEKGYTKEVEVEDDPTETKKDD----------------QDDQT 333

  Fly   253 DKKDKDAKKKKTIKEKYTEDEELNKTKPIWTRNPDDISQEEYGEFYKSLTNDWEDHLAVKHFSVE 317
            :||    ||.|.:.|:|.:.|..|:|:|||.|||.:::..||.|||:...|::.|.||..||:.|
plant   334 EKK----KKTKKVVERYWDWELTNETQPIWLRNPKEVTTAEYNEFYRKAFNEYLDPLASSHFTTE 394

  Fly   318 GQLEFRALLFIPRRTPF--DLFENQKKRNNIKLYVRRVFIMDNCE-DLIPEYLNFMKGVVDSEDL 379
            |::|||::|::|..:|.  |...|||.: ||:|||:||||.|:.: :|.|.||:|:||||||.||
plant   395 GEVEFRSILYVPPVSPSGKDDIVNQKTK-NIRLYVKRVFISDDFDGELFPRYLSFVKGVVDSHDL 458

  Fly   380 PLNISREMLQQNKVLKVIRKNLVKKTMELI--EELTEDKENYKKFYDQFSKNLKLGVHEDSNNRA 442
            |||:|||:||:::::::::|.||:|..::|  ..|:|::|:|:||:|.|.|:||||..||..|..
plant   459 PLNVSREILQESRIVRIMKKRLVRKAFDMILGISLSENREDYEKFWDNFGKHLKLGCIEDRENHK 523

  Fly   443 KLADFLRFHTSASGDDFCSLADYVSRMKDNQKHVYFITGESKDQVSNSAFVERVKARGFEVVYMT 507
            ::|..|||.:|.|.:|..||.:||..||..||.:|||..:|.....|:.|:|::..:|.||:|:.
plant   524 RIAPLLRFFSSQSENDMISLDEYVENMKPEQKAIYFIASDSITSAKNAPFLEKMLEKGLEVLYLV 588

  Fly   508 EPIDEYVIQHLKEYKGKQLVSVTKEGLELPEDESEKKKREEDKAKFESLCKLMKSILDNKVEKVV 572
            |||||..:|.||.||.|..|.::||.|:|.:...||:...  |.:|...|..:|..|.:||..|.
plant   589 EPIDEVAVQSLKAYKEKDFVDISKEDLDLGDKNEEKEAAV--KKEFGQTCDWIKKRLGDKVASVQ 651

  Fly   573 VSNRLVDSPCCIVTSQFGWSANMERIMKAQALRDTATMGYMAGKKQLEINPDHPIVETLRQKADA 637
            :||||..|||.:|:.:|||||||||:||||:..||.::.||.|::..||||||.|::.:....::
plant   652 ISNRLSSSPCVLVSGKFGWSANMERLMKAQSTGDTISLDYMKGRRVFEINPDHSIIKNINAAYNS 716

  Fly   638 DKNDKAVKDLVILLFETSLLSSGFSLDSPQVHASRIYRMIKLGLGIDEDEPMTTDDAQSAGDAPS 702
            :.||:.....:.|:::.:|:||||:.|:|.....:||.|:.:.|......|......|..  |.|
plant   717 NPNDEDAMRAIDLMYDAALVSSGFTPDNPAELGGKIYEMMDVALSGKWSSPEVQPQQQQM--AHS 779

  Fly   703 LVEDTEDASHMEEVD 717
            ...:|.:|..:|.|:
plant   780 HDAETFEAEVVEPVE 794

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Hsp83NP_001261362.1 PTZ00272 6..717 CDD:240341 313/725 (43%)
HATPase_c 28..179 CDD:214643 86/160 (54%)
HSP90 184..706 CDD:278607 210/527 (40%)
Hsp89.1NP_001319498.1 PRK05218 95..756 CDD:235366 304/685 (44%)
HATPase_c 122..276 CDD:280651 82/155 (53%)
HSP90 282..768 CDD:278607 207/509 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D924636at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126623
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.