DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hsp83 and hsp90aa1.2

Sequence 1:NP_001261362.1 Gene:Hsp83 FlyBaseID:FBgn0001233 Length:717 Species:Drosophila melanogaster
Sequence 2:NP_001072765.1 Gene:hsp90aa1.2 XenbaseID:XB-GENE-920475 Length:714 Species:Xenopus tropicalis

Alignment Length:718 Identity:558/719 (78%)
Similarity:641/719 (89%) Gaps:5/719 (1%)


  Fly     1 MPEEAETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNASDALDKIRYESLTDPSKLDSGKELY 65
            |.:|.||||||||||||||||||||||||||||||:|||:||||||||||||||||||||||||.
 Frog     1 MEDEVETFAFQAEIAQLMSLIINTFYSNKEIFLREIISNSSDALDKIRYESLTDPSKLDSGKELK 65

  Fly    66 IKLIPNKTAGTLTIIDTGIGMTKSDLVNNLGTIAKSGTKAFMEALQAGADISMIGQFGVGFYSAY 130
            |.||||:...|||||||||||||:||:||||||||||||||||||||||||||||||||||||||
 Frog    66 IDLIPNRRDRTLTIIDTGIGMTKADLINNLGTIAKSGTKAFMEALQAGADISMIGQFGVGFYSAY 130

  Fly   131 LVADKVTVTSKNNDDEQYVWESSAGGSFTVRADNSEPLGRGTKIVLYIKEDQTDYLEESKIKEIV 195
            |||:||||.:|::|||||.|||||||||||||||:||||||||::|::|||||:||||.:|||||
 Frog   131 LVAEKVTVITKHSDDEQYAWESSAGGSFTVRADNTEPLGRGTKVILHLKEDQTEYLEERRIKEIV 195

  Fly   196 NKHSQFIGYPIKLLVEKEREKEVSDDEADDEKKEGDEKKEMETDEPKIEDVGEDEDADKKDKDAK 260
            .:|||||||||.|.:||||:||:||||::::.   ||||:.:.|:.:|||||.||:.|.|..|.|
 Frog   196 KRHSQFIGYPITLYMEKERDKEISDDESEEQI---DEKKDEKKDKTEIEDVGSDEEEDAKKGDKK 257

  Fly   261 KK-KTIKEKYTEDEELNKTKPIWTRNPDDISQEEYGEFYKSLTNDWEDHLAVKHFSVEGQLEFRA 324
            || |.|||||.:.|||||||||||||||||:.||||||||||||||||||||||||:||||||||
 Frog   258 KKTKKIKEKYIDQEELNKTKPIWTRNPDDITNEEYGEFYKSLTNDWEDHLAVKHFSIEGQLEFRA 322

  Fly   325 LLFIPRRTPFDLFENQKKRNNIKLYVRRVFIMDNCEDLIPEYLNFMKGVVDSEDLPLNISREMLQ 389
            |||:|||.||||||::||:|||||||||||||||||:|||||||.:|||||||||||||||||||
 Frog   323 LLFVPRRAPFDLFESKKKKNNIKLYVRRVFIMDNCEELIPEYLNIIKGVVDSEDLPLNISREMLQ 387

  Fly   390 QNKVLKVIRKNLVKKTMELIEELTEDKENYKKFYDQFSKNLKLGVHEDSNNRAKLADFLRFHTSA 454
            |:|:|||||||||||.:||..||:||||||||.|:|||||:|||:||||.||.||::.||:::||
 Frog   388 QSKILKVIRKNLVKKCLELFTELSEDKENYKKLYEQFSKNIKLGIHEDSQNRKKLSELLRYYSSA 452

  Fly   455 SGDDFCSLADYVSRMKDNQKHVYFITGESKDQVSNSAFVERVKARGFEVVYMTEPIDEYVIQHLK 519
            |||:..||::||||||:||||:|:||||:|||||:|||||.::..|.||:|||||||||.:|.||
 Frog   453 SGDEMISLSEYVSRMKENQKHIYYITGETKDQVSHSAFVEGLRKHGLEVIYMTEPIDEYCVQQLK 517

  Fly   520 EYKGKQLVSVTKEGLELPEDESEKKKREEDKAKFESLCKLMKSILDNKVEKVVVSNRLVDSPCCI 584
            |:.||.|||||||||||||||.||||:||.|.|||:|||::|.|||.|||||::|||||:|||||
 Frog   518 EFDGKTLVSVTKEGLELPEDEEEKKKQEEKKTKFENLCKVIKEILDKKVEKVLLSNRLVESPCCI 582

  Fly   585 VTSQFGWSANMERIMKAQALRDTATMGYMAGKKQLEINPDHPIVETLRQKADADKNDKAVKDLVI 649
            |||.:|||||||||||||||||.:||||||.||.||||.||||:|||||||:||||||:|||||.
 Frog   583 VTSTYGWSANMERIMKAQALRDNSTMGYMAAKKHLEINCDHPIIETLRQKAEADKNDKSVKDLVN 647

  Fly   650 LLFETSLLSSGFSLDSPQVHASRIYRMIKLGLGIDEDEPMTTDDAQSAGDAPSLVEDTEDASHME 714
            |||||:|||||||||.||.|::|||||||||||||||.....:::.:..|.|.| |..||||.||
 Frog   648 LLFETALLSSGFSLDDPQTHSNRIYRMIKLGLGIDEDSFAEEEESPAIQDMPPL-EGDEDASRME 711

  Fly   715 EVD 717
            |||
 Frog   712 EVD 714

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Hsp83NP_001261362.1 PTZ00272 6..717 CDD:240341 555/712 (78%)
HATPase_c 28..179 CDD:214643 130/151 (86%)
HSP90 184..706 CDD:278607 390/523 (75%)
hsp90aa1.2NP_001072765.1 PTZ00272 6..714 CDD:240341 555/712 (78%)
HATPase_c 28..179 CDD:214643 130/151 (86%)
HSP90 184..704 CDD:278607 390/524 (74%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D174605at33208
OrthoFinder 1 1.000 FOG0000421
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.