DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hsp83 and hsp90ab1

Sequence 1:NP_001261362.1 Gene:Hsp83 FlyBaseID:FBgn0001233 Length:717 Species:Drosophila melanogaster
Sequence 2:NP_001025655.1 Gene:hsp90ab1 XenbaseID:XB-GENE-495311 Length:723 Species:Xenopus tropicalis

Alignment Length:715 Identity:564/716 (79%)
Similarity:636/716 (89%) Gaps:1/716 (0%)


  Fly     3 EEAETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNASDALDKIRYESLTDPSKLDSGKELYIK 67
            ||.|||||||||||||||||||||||||||||||||||||||||||||||||||||||||:|.|.
 Frog    10 EEVETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNASDALDKIRYESLTDPSKLDSGKDLKID 74

  Fly    68 LIPNKTAGTLTIIDTGIGMTKSDLVNNLGTIAKSGTKAFMEALQAGADISMIGQFGVGFYSAYLV 132
            :|||:...|||:|||||||||:||:||||||||||||||||||||||||||||||||||||||||
 Frog    75 IIPNRQERTLTVIDTGIGMTKADLINNLGTIAKSGTKAFMEALQAGADISMIGQFGVGFYSAYLV 139

  Fly   133 ADKVTVTSKNNDDEQYVWESSAGGSFTVRADNSEPLGRGTKIVLYIKEDQTDYLEESKIKEIVNK 197
            |:||.|.:|:||||||.|||||||||||:.|:.||:|||||::||:|||||:||||.::||.|.|
 Frog   140 AEKVLVITKHNDDEQYAWESSAGGSFTVKTDHGEPIGRGTKVILYLKEDQTEYLEEKRVKETVKK 204

  Fly   198 HSQFIGYPIKLLVEKEREKEVSDDEADDEKKEGDEKKEMETDEPKIEDVGEDEDADKKDKDAKKK 262
            |||||||||.|.:|||||||:|||||::||:|..:::|.|.|:|||||||.||:.:.||| .||.
 Frog   205 HSQFIGYPITLYLEKEREKEISDDEAEEEKEEEKKEEEGENDKPKIEDVGSDEEEEGKDK-KKKT 268

  Fly   263 KTIKEKYTEDEELNKTKPIWTRNPDDISQEEYGEFYKSLTNDWEDHLAVKHFSVEGQLEFRALLF 327
            |.|||||.:.|||||||||||||||||:|||||||||||||||||||||||||||||||||||||
 Frog   269 KKIKEKYIDQEELNKTKPIWTRNPDDITQEEYGEFYKSLTNDWEDHLAVKHFSVEGQLEFRALLF 333

  Fly   328 IPRRTPFDLFENQKKRNNIKLYVRRVFIMDNCEDLIPEYLNFMKGVVDSEDLPLNISREMLQQNK 392
            ||||.|||||||:||:||||||||||||||:|::||||||||::|||||||||||||||||||:|
 Frog   334 IPRRAPFDLFENKKKKNNIKLYVRRVFIMDSCDELIPEYLNFIRGVVDSEDLPLNISREMLQQSK 398

  Fly   393 VLKVIRKNLVKKTMELIEELTEDKENYKKFYDQFSKNLKLGVHEDSNNRAKLADFLRFHTSASGD 457
            :|||||||:|||.:||..||.||||||||||:.||||||||:||||.||.||::.||:|||.:||
 Frog   399 ILKVIRKNIVKKCLELFTELAEDKENYKKFYEAFSKNLKLGIHEDSTNRKKLSELLRYHTSQTGD 463

  Fly   458 DFCSLADYVSRMKDNQKHVYFITGESKDQVSNSAFVERVKARGFEVVYMTEPIDEYVIQHLKEYK 522
            :..||.:||||||:|||.:|:|||||||||:||||||||:.|||||||||||||||.:|.|||:.
 Frog   464 EMASLTEYVSRMKENQKSIYYITGESKDQVANSAFVERVRKRGFEVVYMTEPIDEYCVQQLKEFD 528

  Fly   523 GKQLVSVTKEGLELPEDESEKKKREEDKAKFESLCKLMKSILDNKVEKVVVSNRLVDSPCCIVTS 587
            ||.|||||||||||||||.|||..||:|.||||||||||.|||.|||||.||||||.||||||||
 Frog   529 GKTLVSVTKEGLELPEDEEEKKMMEENKTKFESLCKLMKEILDKKVEKVTVSNRLVSSPCCIVTS 593

  Fly   588 QFGWSANMERIMKAQALRDTATMGYMAGKKQLEINPDHPIVETLRQKADADKNDKAVKDLVILLF 652
            .:||:||||||||||||||.:|||||..||.|||||:|||||||||||:.|||||||||||:|||
 Frog   594 TYGWTANMERIMKAQALRDNSTMGYMMAKKHLEINPEHPIVETLRQKAETDKNDKAVKDLVVLLF 658

  Fly   653 ETSLLSSGFSLDSPQVHASRIYRMIKLGLGIDEDEPMTTDDAQSAGDAPSLVEDTEDASHMEEVD 717
            ||:|||||||||.||.|::|||||||||||||:|:....:.:.|..|....:|..||||.|||||
 Frog   659 ETALLSSGFSLDDPQTHSNRIYRMIKLGLGIDDDDATVEETSPSVADEIPPLEGDEDASRMEEVD 723

  Fly   718  717
             Frog   724  723

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Hsp83NP_001261362.1 PTZ00272 6..717 CDD:240341 561/711 (79%)
HATPase_c 28..179 CDD:214643 126/151 (83%)
HSP90 184..706 CDD:278607 400/522 (77%)
hsp90ab1NP_001025655.1 PTZ00272 13..723 CDD:240341 561/711 (79%)
HATPase_c 35..186 CDD:214643 126/151 (83%)
HSP90 191..713 CDD:278607 400/523 (76%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C70475574
eggNOG 1 0.900 E1_COG0326
Hieranoid 1 1.000
Homologene 1 1.000 H74306
Inparanoid 1 1.050 1138 1.000 Inparanoid score I191
OMA 1 1.010
OrthoDB 1 1.010 D174605at33208
OrthoFinder 1 1.000 FOG0000421
OrthoInspector 1 1.000 T600645
Phylome 1 0.910 0.933 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R576
TreeFam 1 0.960
1211.800

Return to query results.
Submit another query.