DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hsp83 and hsp90aa1.1

Sequence 1:NP_001261362.1 Gene:Hsp83 FlyBaseID:FBgn0001233 Length:717 Species:Drosophila melanogaster
Sequence 2:NP_001016282.1 Gene:hsp90aa1.1 XenbaseID:XB-GENE-495303 Length:729 Species:Xenopus tropicalis

Alignment Length:719 Identity:566/720 (79%)
Similarity:642/720 (89%) Gaps:5/720 (1%)


  Fly     1 MPEEAETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNASDALDKIRYESLTDPSKLDSGKELY 65
            |.|:.||||||||||||||||||||||||||||||||||:||||||||||||||||||||||||.
 Frog    14 MEEDVETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNSSDALDKIRYESLTDPSKLDSGKELK 78

  Fly    66 IKLIPNKTAGTLTIIDTGIGMTKSDLVNNLGTIAKSGTKAFMEALQAGADISMIGQFGVGFYSAY 130
            |.|||||...|||||||||||||:||:||||||||||||||||||||||||||||||||||||||
 Frog    79 IYLIPNKQDRTLTIIDTGIGMTKADLINNLGTIAKSGTKAFMEALQAGADISMIGQFGVGFYSAY 143

  Fly   131 LVADKVTVTSKNNDDEQYVWESSAGGSFTVRADNSEPLGRGTKIVLYIKEDQTDYLEESKIKEIV 195
            |||:||||.:|:||||||.|||||||||||:.||.||||||||::||:||||::|.||.:|||.|
 Frog   144 LVAEKVTVITKHNDDEQYAWESSAGGSFTVKVDNGEPLGRGTKVILYLKEDQSEYFEEKRIKETV 208

  Fly   196 NKHSQFIGYPIKLLVEKEREKEVSDDEADDEKKEGDEKKEMETDE--PKIEDVGEDEDADKKDKD 258
            .||||||||||.|.|||||:||:|||||::||   :||||...||  |:|||||.||:.|||:.|
 Frog   209 KKHSQFIGYPITLFVEKERDKEISDDEAEEEK---EEKKEEAKDEEKPEIEDVGSDEEDDKKEGD 270

  Fly   259 AKKKKTIKEKYTEDEELNKTKPIWTRNPDDISQEEYGEFYKSLTNDWEDHLAVKHFSVEGQLEFR 323
            .||||.|||||.:.|||||||||||||||||:.||||||||||||||||||||||||||||||||
 Frog   271 KKKKKKIKEKYIDQEELNKTKPIWTRNPDDITNEEYGEFYKSLTNDWEDHLAVKHFSVEGQLEFR 335

  Fly   324 ALLFIPRRTPFDLFENQKKRNNIKLYVRRVFIMDNCEDLIPEYLNFMKGVVDSEDLPLNISREML 388
            ||||:|||.|||||||:||:|||||||||||||||||:||||||||::|||||||||||||||||
 Frog   336 ALLFVPRRAPFDLFENRKKKNNIKLYVRRVFIMDNCEELIPEYLNFIRGVVDSEDLPLNISREML 400

  Fly   389 QQNKVLKVIRKNLVKKTMELIEELTEDKENYKKFYDQFSKNLKLGVHEDSNNRAKLADFLRFHTS 453
            ||:|:|||||||||||.:||..||:||||||||||:|||||:|||:||||.||.||::.||::||
 Frog   401 QQSKILKVIRKNLVKKCLELFTELSEDKENYKKFYEQFSKNIKLGIHEDSQNRNKLSELLRYYTS 465

  Fly   454 ASGDDFCSLADYVSRMKDNQKHVYFITGESKDQVSNSAFVERVKARGFEVVYMTEPIDEYVIQHL 518
            ||||:..||.||.:|||::|||:|:||||:|:||::||||||::..|.||:||.||||||.:|.|
 Frog   466 ASGDEMVSLKDYCTRMKESQKHIYYITGETKEQVAHSAFVERLRKHGLEVIYMIEPIDEYCVQQL 530

  Fly   519 KEYKGKQLVSVTKEGLELPEDESEKKKREEDKAKFESLCKLMKSILDNKVEKVVVSNRLVDSPCC 583
            ||::||.|||||||||||||||.||||:||.|:|||:|||:||.||:.||||||||||||.||||
 Frog   531 KEFEGKTLVSVTKEGLELPEDEEEKKKQEEKKSKFENLCKIMKDILEKKVEKVVVSNRLVTSPCC 595

  Fly   584 IVTSQFGWSANMERIMKAQALRDTATMGYMAGKKQLEINPDHPIVETLRQKADADKNDKAVKDLV 648
            ||||.:||:||||||||||||||.:||||||.||.|||||||.|:||||||||:|||||:|||||
 Frog   596 IVTSTYGWTANMERIMKAQALRDNSTMGYMAAKKHLEINPDHSIIETLRQKADSDKNDKSVKDLV 660

  Fly   649 ILLFETSLLSSGFSLDSPQVHASRIYRMIKLGLGIDEDEPMTTDDAQSAGDAPSLVEDTEDASHM 713
            ||||||:||||||||:.||.||:|||||||||||||||:..|.|.:..|.:....:|..||:|.|
 Frog   661 ILLFETALLSSGFSLEDPQTHANRIYRMIKLGLGIDEDDTATEDLSAPATEEMPPLEGDEDSSRM 725

  Fly   714 EEVD 717
            ||||
 Frog   726 EEVD 729

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Hsp83NP_001261362.1 PTZ00272 6..717 CDD:240341 563/713 (79%)
HATPase_c 28..179 CDD:214643 132/151 (87%)
HSP90 184..706 CDD:278607 398/524 (76%)
hsp90aa1.1NP_001016282.1 PTZ00272 19..729 CDD:240341 563/713 (79%)
HATPase_c 41..192 CDD:214643 132/151 (87%)
HSP90 197..719 CDD:278607 398/525 (76%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C70470575
eggNOG 1 0.900 E1_COG0326
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 1138 1.000 Inparanoid score I191
OMA 1 1.010
OrthoDB 1 1.010 D174605at33208
OrthoFinder 1 1.000 FOG0000421
OrthoInspector 1 1.000 T600645
Phylome 1 0.910 0.933 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R576
TreeFam 1 0.960
1110.800

Return to query results.
Submit another query.