DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hsp83 and Gp93

Sequence 1:NP_001261362.1 Gene:Hsp83 FlyBaseID:FBgn0001233 Length:717 Species:Drosophila melanogaster
Sequence 2:NP_651601.1 Gene:Gp93 FlyBaseID:FBgn0039562 Length:787 Species:Drosophila melanogaster

Alignment Length:741 Identity:334/742 (45%)
Similarity:486/742 (65%) Gaps:50/742 (7%)


  Fly     3 EEAETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNASDALDKIRYESLTDPSKLDSGKELYIK 67
            |:|:.|.||.|:.::|.||||:.|.||||||||||||||||:||||..:|::..:|::..||:|:
  Fly    70 EKAKKFTFQTEVNRMMKLIINSLYRNKEIFLRELISNASDAIDKIRLLALSNSKELETNPELHIR 134

  Fly    68 LIPNKTAGTLTIIDTGIGMTKSDLVNNLGTIAKSGTKAFMEALQ-----AGADIS-MIGQFGVGF 126
            :..:|....|.|:|:|||||..||:|||||||||||..|:..:|     .|.|:: |||||||||
  Fly   135 IKADKENKALHIMDSGIGMTHQDLINNLGTIAKSGTADFLAKMQDPSKSEGLDMNDMIGQFGVGF 199

  Fly   127 YSAYLVADKVTVTSKNNDDEQYVWESSAGGSFTVRAD-NSEPLGRGTKIVLYIKEDQTDYLEESK 190
            |||:||||:|.||:|:|||:||:|||.| .||::..| ..:.|.||:.|.||:||:..|:|||..
  Fly   200 YSAFLVADRVVVTTKHNDDKQYIWESDA-NSFSITEDPRGDTLKRGSVISLYLKEEAQDFLEEDT 263

  Fly   191 IKEIVNKHSQFIGYPIKLLVEKEREKEVS-DDEADDEKKEGDEKKEMETDEPKIEDVGEDEDADK 254
            ::|::.|:||||.:||::...|..|:||. ::||..||.|.|.               |||||..
  Fly   264 VRELIRKYSQFINFPIRMWSSKTVEEEVPVEEEAKPEKSEDDV---------------EDEDAKV 313

  Fly   255 KDKDAKKKKTIK-EKYTEDEEL-NKTKPIWTRNPDDISQEEYGEFYKSLTNDWEDHLAVKHFSVE 317
            ::.:.:|.||.| .|.|.|..| |.:||||||.|.:::::||..||||||.|..:.|...||..|
  Fly   314 EEAEDEKPKTKKVSKTTWDWTLINDSKPIWTRKPAEVTEDEYTSFYKSLTKDSSEPLTQTHFIAE 378

  Fly   318 GQLEFRALLFIPRRTPFDLFENQ-KKRNNIKLYVRRVFIMDNCEDLIPEYLNFMKGVVDSEDLPL 381
            |::.|::||::|:..|.:.|... .|.:|||||||||||.|...|::|.||:|::|||||:||||
  Fly   379 GEVTFKSLLYVPKVQPSESFNRYGTKSDNIKLYVRRVFITDEFNDMMPNYLSFIRGVVDSDDLPL 443

  Fly   382 NISREMLQQNKVLKVIRKNLVKKTMELIEELTEDKENYKKFYDQFSKNLKLGVHEDSNNRAKLAD 446
            |:|||.|||:|::|||:|.||:|.:::::::  |||.|:||:.:||.|:||||.||.:||::||.
  Fly   444 NVSRETLQQHKLIKVIKKKLVRKVLDMLKKI--DKEAYEKFWKEFSTNIKLGVMEDPSNRSRLAK 506

  Fly   447 FLRFHTSASGDDFCSLADYVSRMKDNQKHVYFITGESKDQVSNSAFVERVKARGFEVVYMTEPID 511
            .|||.|| :|....|||:|..|||..|:|:|:|.|.::.:|..|.||||:.::|:||:|:.|.:|
  Fly   507 LLRFQTS-NGKGVTSLAEYKERMKAKQEHIYYIAGANRAEVEKSPFVERLLSKGYEVLYLVEAVD 570

  Fly   512 EYVIQHLKEYKGKQLVSVTKEGLELPEDESEKKKREEDKAKFESLCKLMKSI-LDNKVEKVVVSN 575
            ||.|..|.|:.||:..:|.|||.:|.|.|..||..|..|:.||.|.|.:..: |.:::.|..||.
  Fly   571 EYCISALPEFDGKKFQNVAKEGFQLNESEKSKKNFESLKSTFEPLVKWLNDVALKDQISKAQVSE 635

  Fly   576 RLVDSPCCIVTSQFGWSANMERIMKAQALR---DTATMGYMAGKKQLEINPDHPIVETLRQKADA 637
            ||.:|||.:|...|||:.||||:..:.|.:   |.....|:..||.|||||.||::..|.::.:|
  Fly   636 RLSNSPCALVAGVFGWTGNMERLAMSNAHQKSDDPQRTYYLNQKKTLEINPRHPLMRELLRRVEA 700

  Fly   638 DKNDKAVKDLVILLFETSLLSSGFSLDSPQVHASRIYRMIKLGLGIDEDEPMTTDD--------- 693
            |:.|...||:.:::|.|:.|.||:.|......|..|.:|::..||:.:||.:..|:         
  Fly   701 DEADDTAKDMAVMMFRTATLRSGYMLQETSQFADSIEQMMRQTLGVSQDEQVEFDEEEEDDAEET 765

  Fly   694 ---AQSAGDAPSLVEDTEDASHMEEV 716
               :|.:|:|    :|.|:....:|:
  Fly   766 ATGSQESGNA----DDEEEEQQHDEL 787

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Hsp83NP_001261362.1 PTZ00272 6..717 CDD:240341 332/739 (45%)
HATPase_c 28..179 CDD:214643 89/158 (56%)
HSP90 184..706 CDD:278607 228/542 (42%)
Gp93NP_651601.1 PRK05218 74..745 CDD:235366 322/690 (47%)
HATPase_c 97..216 CDD:238030 69/119 (58%)
HSP90 257..748 CDD:278607 222/509 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C71839596
eggNOG 1 0.900 E1_COG0326
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D174605at33208
OrthoFinder 1 1.000 FOG0000421
orthoMCL 1 0.900 OOG5_126623
Panther 1 1.100 P PTHR11528
RoundUp 00.000 Not matched by this tool.
65.840

Return to query results.
Submit another query.