DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hsp83 and Hsp90b1

Sequence 1:NP_001261362.1 Gene:Hsp83 FlyBaseID:FBgn0001233 Length:717 Species:Drosophila melanogaster
Sequence 2:NP_001012197.2 Gene:Hsp90b1 RGDID:1310482 Length:804 Species:Rattus norvegicus

Alignment Length:728 Identity:349/729 (48%)
Similarity:484/729 (66%) Gaps:35/729 (5%)


  Fly     3 EEAETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNASDALDKIRYESLTDPSKLDSGKELYIK 67
            |::|.||||||:.::|.||||:.|.|||||||||||||||||||||..||||.:.|...:||.:|
  Rat    71 EKSEKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALAGNEELTVK 135

  Fly    68 LIPNKTAGTLTIIDTGIGMTKSDLVNNLGTIAKSGTKAFM----EALQAGADIS-MIGQFGVGFY 127
            :..::....|.:.|||:|||:.:||.||||||||||..|:    ||.:.|...| :|||||||||
  Rat   136 IKCDREKNLLHVTDTGVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDGQSTSELIGQFGVGFY 200

  Fly   128 SAYLVADKVTVTSKNNDDEQYVWESSAGGSFTVRAD-NSEPLGRGTKIVLYIKEDQTDYLEESKI 191
            ||:||||||.||||:|:|.|::|||.: ..|:|.|| ....|||||.|.|.:||:.:||||...|
  Rat   201 SAFLVADKVIVTSKHNNDTQHIWESDS-NEFSVIADPRGNTLGRGTTITLVLKEEASDYLELDTI 264

  Fly   192 KEIVNKHSQFIGYPIKLLVEKER--EKEVSDDE-ADDEKKEGDEKKEMETDEPKIEDVGEDEDAD 253
            |.:|.|:||||.:||.:...|..  |:.:.:|| |.:||:|.|       ||..:    |:|:.:
  Rat   265 KNLVRKYSQFINFPIYVWSSKTETVEEPLEEDETAQEEKEEAD-------DEAAV----EEEEEE 318

  Fly   254 KKDKDAKKKKTIKEKYTEDEELNKTKPIWTRNPDDISQEEYGEFYKSLTNDWEDHLAVKHFSVEG 318
            ||.|..|.:||:    .:.|.:|..||||.|...::.::||..||||.:.:.:|.:|..||:.||
  Rat   319 KKPKTKKVEKTV----WDWELMNDIKPIWQRPSKEVEEDEYKAFYKSFSKESDDPMAYIHFTAEG 379

  Fly   319 QLEFRALLFIPRRTPFDLFE--NQKKRNNIKLYVRRVFIMDNCEDLIPEYLNFMKGVVDSEDLPL 381
            ::.|:::||:|...|..||:  ..||.:.||||||||||.|:..|::|:||||:||||||:||||
  Rat   380 EVTFKSILFVPTSAPRGLFDEYGSKKSDYIKLYVRRVFITDDFHDMMPKYLNFVKGVVDSDDLPL 444

  Fly   382 NISREMLQQNKVLKVIRKNLVKKTMELIEELTEDKENYKKFYDQFSKNLKLGVHEDSNNRAKLAD 446
            |:|||.|||:|:||||||.||:||:::|:::.::|.| ..|:.:|..|:||||.||.:||.:||.
  Rat   445 NVSRETLQQHKLLKVIRKKLVRKTLDMIKKIADEKYN-DTFWKEFGTNIKLGVIEDHSNRTRLAK 508

  Fly   447 FLRFHTSASGDDFCSLADYVSRMKDNQKHVYFITGESKDQVSNSAFVERVKARGFEVVYMTEPID 511
            .|||.:|....|..||..||.|||:.|..:||:.|.|:.:..:|.||||:..:|:||:|:|||:|
  Rat   509 LLRFQSSHHSTDITSLDQYVERMKEKQDKIYFMAGSSRKEAESSPFVERLLKKGYEVIYLTEPVD 573

  Fly   512 EYVIQHLKEYKGKQLVSVTKEGLELPEDESEKKKREEDKAKFESLCKLMK-SILDNKVEKVVVSN 575
            ||.||.|.|:.||:..:|.|||::..|.|..|:.||..:.:||.|...|| ..|.:|:||.|||.
  Rat   574 EYCIQALPEFDGKRFQNVAKEGVKFDESEKSKESREATEKEFEPLLNWMKDKALKDKIEKAVVSQ 638

  Fly   576 RLVDSPCCIVTSQFGWSANMERIMKAQAL---RDTATMGYMAGKKQLEINPDHPIVETLRQKADA 637
            ||.:|||.:|.||:|||.||||||||||.   :|.:|..|.:.||..||||.||::..:.::...
  Rat   639 RLTESPCALVASQYGWSGNMERIMKAQAYQTGKDISTNYYASQKKTFEINPRHPLIRDMLRRVKE 703

  Fly   638 DKNDKAVKDLVILLFETSLLSSGFSLDSPQVHASRIYRMIKLGLGIDEDEPMTTDDAQSAGDAPS 702
            |::||.|.||.::||||:.|.||:.|...:.:..||.||::|.|.||.:..:..:..:...|.  
  Rat   704 DEDDKTVMDLAVVLFETATLRSGYLLPDTKAYGDRIERMLRLSLNIDPEAQVEEEPEEEPEDT-- 766

  Fly   703 LVEDTEDASHMEE 715
             .|||.|.|..:|
  Rat   767 -TEDTTDDSEQDE 778

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Hsp83NP_001261362.1 PTZ00272 6..717 CDD:240341 348/726 (48%)
HATPase_c 28..179 CDD:214643 91/157 (58%)
HSP90 184..706 CDD:278607 237/531 (45%)
Hsp90b1NP_001012197.2 PRK05218 74..746 CDD:235366 338/689 (49%)
HATPase_c 96..254 CDD:214643 93/159 (58%)
HSP90 257..755 CDD:278607 235/514 (46%)
Prevents secretion from ER. {ECO:0000255} 801..804
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0326
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D174605at33208
OrthoFinder 1 1.000 FOG0000421
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126623
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.