DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hsp83 and Hsp90ab1

Sequence 1:NP_001261362.1 Gene:Hsp83 FlyBaseID:FBgn0001233 Length:717 Species:Drosophila melanogaster
Sequence 2:NP_001004082.3 Gene:Hsp90ab1 RGDID:1303075 Length:724 Species:Rattus norvegicus

Alignment Length:716 Identity:564/717 (79%)
Similarity:638/717 (89%) Gaps:2/717 (0%)


  Fly     3 EEAETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNASDALDKIRYESLTDPSKLDSGKELYIK 67
            ||.|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||.|.
  Rat    10 EEVETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNASDALDKIRYESLTDPSKLDSGKELKID 74

  Fly    68 LIPNKTAGTLTIIDTGIGMTKSDLVNNLGTIAKSGTKAFMEALQAGADISMIGQFGVGFYSAYLV 132
            :|||....|||::||||||||:||:||||||||||||||||||||||||||||||||||||||||
  Rat    75 IIPNPQERTLTLVDTGIGMTKADLINNLGTIAKSGTKAFMEALQAGADISMIGQFGVGFYSAYLV 139

  Fly   133 ADKVTVTSKNNDDEQYVWESSAGGSFTVRADNSEPLGRGTKIVLYIKEDQTDYLEESKIKEIVNK 197
            |:||.|.:|:||||||.||||||||||||||:.||:|||||::|::|||||:||||.::||:|.|
  Rat   140 AEKVVVITKHNDDEQYAWESSAGGSFTVRADHGEPIGRGTKVILHLKEDQTEYLEERRVKEVVKK 204

  Fly   198 HSQFIGYPIKLLVEKEREKEVSDDEADDEKKEGDEKKEMETDEPKIEDVGEDEDADKKDKDAKKK 262
            |||||||||.|.:|||||||:|||||::||.|.:|:.:.:.::|||||||.||: |...||.|||
  Rat   205 HSQFIGYPITLYLEKEREKEISDDEAEEEKGEKEEEDKEDEEKPKIEDVGSDEE-DDSGKDKKKK 268

  Fly   263 -KTIKEKYTEDEELNKTKPIWTRNPDDISQEEYGEFYKSLTNDWEDHLAVKHFSVEGQLEFRALL 326
             |.|||||.:.|||||||||||||||||:||||||||||||||||||||||||||||||||||||
  Rat   269 TKKIKEKYIDQEELNKTKPIWTRNPDDITQEEYGEFYKSLTNDWEDHLAVKHFSVEGQLEFRALL 333

  Fly   327 FIPRRTPFDLFENQKKRNNIKLYVRRVFIMDNCEDLIPEYLNFMKGVVDSEDLPLNISREMLQQN 391
            |||||.|||||||:||:||||||||||||||:|::||||||||::|||||||||||||||||||:
  Rat   334 FIPRRAPFDLFENKKKKNNIKLYVRRVFIMDSCDELIPEYLNFIRGVVDSEDLPLNISREMLQQS 398

  Fly   392 KVLKVIRKNLVKKTMELIEELTEDKENYKKFYDQFSKNLKLGVHEDSNNRAKLADFLRFHTSASG 456
            |:|||||||:|||.:||..||.||||||||||:.||||||||:||||.||.:|::.||:|||.||
  Rat   399 KILKVIRKNIVKKCLELFSELAEDKENYKKFYEAFSKNLKLGIHEDSTNRRRLSELLRYHTSQSG 463

  Fly   457 DDFCSLADYVSRMKDNQKHVYFITGESKDQVSNSAFVERVKARGFEVVYMTEPIDEYVIQHLKEY 521
            |:..||::||||||:.||.:|:||||||:||:||||||||:.|||||||||||||||.:|.|||:
  Rat   464 DEMTSLSEYVSRMKETQKSIYYITGESKEQVANSAFVERVRKRGFEVVYMTEPIDEYCVQQLKEF 528

  Fly   522 KGKQLVSVTKEGLELPEDESEKKKREEDKAKFESLCKLMKSILDNKVEKVVVSNRLVDSPCCIVT 586
            .||.|||||||||||||||.||||.||.|||||:||||||.|||.|||||.:|||||.|||||||
  Rat   529 DGKSLVSVTKEGLELPEDEEEKKKMEESKAKFENLCKLMKEILDKKVEKVTISNRLVSSPCCIVT 593

  Fly   587 SQFGWSANMERIMKAQALRDTATMGYMAGKKQLEINPDHPIVETLRQKADADKNDKAVKDLVILL 651
            |.:||:||||||||||||||.:|||||..||.|||||||||||||||||:||||||||||||:||
  Rat   594 STYGWTANMERIMKAQALRDNSTMGYMMAKKHLEINPDHPIVETLRQKAEADKNDKAVKDLVVLL 658

  Fly   652 FETSLLSSGFSLDSPQVHASRIYRMIKLGLGIDEDEPMTTDDAQSAGDAPSLVEDTEDASHMEEV 716
            |||:||||||||:.||.|::||||||||||||||||....:.:.:..|....:|..||||.||||
  Rat   659 FETALLSSGFSLEDPQTHSNRIYRMIKLGLGIDEDEVTAEEPSAAVPDEIPPLEGDEDASRMEEV 723

  Fly   717 D 717
            |
  Rat   724 D 724

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Hsp83NP_001261362.1 PTZ00272 6..717 CDD:240341 561/712 (79%)
HATPase_c 28..179 CDD:214643 127/151 (84%)
HSP90 184..706 CDD:278607 399/523 (76%)
Hsp90ab1NP_001004082.3 Interaction with TP53. {ECO:0000250|UniProtKB:P08238} 2..527 413/518 (80%)
Interaction with BIRC2. {ECO:0000250|UniProtKB:P08238} 2..214 173/204 (85%)
Interaction with NR3C1. {ECO:0000250|UniProtKB:P11499} 9..231 186/221 (84%)
HSP90 14..724 CDD:332554 560/711 (79%)
Interaction with AHSA1. {ECO:0000250|UniProtKB:P08238} 215..552 261/338 (77%)
Interaction with NR3C1. {ECO:0000250|UniProtKB:P11499} 264..608 278/344 (81%)
Interaction with NR1D1. {ECO:0000250|UniProtKB:P11499} 620..723 73/103 (71%)
TPR repeat-binding 720..724 4/4 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C70462936
eggNOG 1 0.900 E1_COG0326
Hieranoid 1 1.000
Homologene 1 1.000 H74306
Inparanoid 1 1.050 1144 1.000 Inparanoid score I197
OMA 1 1.010
OrthoDB 1 1.010 D174605at33208
OrthoFinder 1 1.000 FOG0000421
OrthoInspector 1 1.000 T617668
orthoMCL 1 0.900 OOG5_126623
Panther 1 1.100 LDO PTHR11528
Phylome 1 0.910 0.933 Consistency score
TreeFam 1 0.960
1312.770

Return to query results.
Submit another query.