DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hsp83 and Hsp90aa1

Sequence 1:NP_001261362.1 Gene:Hsp83 FlyBaseID:FBgn0001233 Length:717 Species:Drosophila melanogaster
Sequence 2:NP_786937.1 Gene:Hsp90aa1 RGDID:631409 Length:733 Species:Rattus norvegicus

Alignment Length:721 Identity:572/722 (79%)
Similarity:646/722 (89%) Gaps:8/722 (1%)


  Fly     3 EEAETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNASDALDKIRYESLTDPSKLDSGKELYIK 67
            ||.||||||||||||||||||||||||||||||||||:||||||||||||||||||||||||:|.
  Rat    15 EEVETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNSSDALDKIRYESLTDPSKLDSGKELHIN 79

  Fly    68 LIPNKTAGTLTIIDTGIGMTKSDLVNNLGTIAKSGTKAFMEALQAGADISMIGQFGVGFYSAYLV 132
            |||||...||||:||||||||:||:||||||||||||||||||||||||||||||||||||||||
  Rat    80 LIPNKQDRTLTIVDTGIGMTKADLINNLGTIAKSGTKAFMEALQAGADISMIGQFGVGFYSAYLV 144

  Fly   133 ADKVTVTSKNNDDEQYVWESSAGGSFTVRADNSEPLGRGTKIVLYIKEDQTDYLEESKIKEIVNK 197
            |:||||.:|:||||||.||||||||||||.|..||:|||||::|::|||||:||||.:|||||.|
  Rat   145 AEKVTVITKHNDDEQYAWESSAGGSFTVRTDTGEPMGRGTKVILHLKEDQTEYLEERRIKEIVKK 209

  Fly   198 HSQFIGYPIKLLVEKEREKEVSDDEAD--DEKKEGDEKKEMETDE-PKIEDVGED-EDADKKDKD 258
            |||||||||.|.|||||:||||||||:  :||:|..||:|.|:|: |:|||||.| |:.:|||.|
  Rat   210 HSQFIGYPITLFVEKERDKEVSDDEAEEKEEKEEEKEKEEKESDDKPEIEDVGSDEEEEEKKDGD 274

  Fly   259 AKKKKTIKEKYTEDEELNKTKPIWTRNPDDISQEEYGEFYKSLTNDWEDHLAVKHFSVEGQLEFR 323
            .||||.|||||.:.|||||||||||||||||:.|||||||||||||||:||||||||||||||||
  Rat   275 KKKKKKIKEKYIDQEELNKTKPIWTRNPDDITNEEYGEFYKSLTNDWEEHLAVKHFSVEGQLEFR 339

  Fly   324 ALLFIPRRTPFDLFENQKKRNNIKLYVRRVFIMDNCEDLIPEYLNFMKGVVDSEDLPLNISREML 388
            ||||:|||.|||||||:||:|||||||||||||||||:||||||||::|||||||||||||||||
  Rat   340 ALLFVPRRAPFDLFENRKKKNNIKLYVRRVFIMDNCEELIPEYLNFIRGVVDSEDLPLNISREML 404

  Fly   389 QQNKVLKVIRKNLVKKTMELIEELTEDKENYKKFYDQFSKNLKLGVHEDSNNRAKLADFLRFHTS 453
            ||:|:|||||||||||.:||..||.||||||||||:|||||:|||:||||.||.||::.||::||
  Rat   405 QQSKILKVIRKNLVKKCLELFTELAEDKENYKKFYEQFSKNIKLGIHEDSQNRKKLSELLRYYTS 469

  Fly   454 ASGDDFCSLADYVSRMKDNQKHVYFITGESKDQVSNSAFVERVKARGFEVVYMTEPIDEYVIQHL 518
            ||||:..||.||.:|||:||||:||||||:||||:|||||||::..|.||:||.||||||.:|.|
  Rat   470 ASGDEMVSLKDYCTRMKENQKHIYFITGETKDQVANSAFVERLRKHGLEVIYMIEPIDEYCVQQL 534

  Fly   519 KEYKGKQLVSVTKEGLELPEDESEKKKREEDKAKFESLCKLMKSILDNKVEKVVVSNRLVDSPCC 583
            ||::||.|||||||||||||||.||||:||.|.|||:|||:||.||:.||||||||||||.||||
  Rat   535 KEFEGKTLVSVTKEGLELPEDEEEKKKQEEKKTKFENLCKIMKDILEKKVEKVVVSNRLVTSPCC 599

  Fly   584 IVTSQFGWSANMERIMKAQALRDTATMGYMAGKKQLEINPDHPIVETLRQKADADKNDKAVKDLV 648
            ||||.:||:||||||||||||||.:||||||.||.|||||||.|:|||||||:||||||:|||||
  Rat   600 IVTSTYGWTANMERIMKAQALRDNSTMGYMAAKKHLEINPDHSIIETLRQKAEADKNDKSVKDLV 664

  Fly   649 ILLFETSLLSSGFSLDSPQVHASRIYRMIKLGLGIDEDEPMTTDDAQSA--GDAPSLVEDTEDAS 711
            |||:||:||||||||:.||.||:|||||||||||||||:| |.||..:|  .:.|.| |..:|.|
  Rat   665 ILLYETALLSSGFSLEDPQTHANRIYRMIKLGLGIDEDDP-TVDDTSAAVTEEMPPL-EGDDDTS 727

  Fly   712 HMEEVD 717
            .|||||
  Rat   728 RMEEVD 733

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Hsp83NP_001261362.1 PTZ00272 6..717 CDD:240341 569/717 (79%)
HATPase_c 28..179 CDD:214643 129/151 (85%)
HSP90 184..706 CDD:278607 407/528 (77%)
Hsp90aa1NP_786937.1 Interaction with NR3C1. {ECO:0000250|UniProtKB:P07901} 9..236 191/221 (86%)
PTZ00272 18..733 CDD:240341 569/717 (79%)
HATPase_c 40..191 CDD:214643 129/151 (85%)
HSP90 196..723 CDD:278607 407/529 (77%)
Interaction with NR3C1. {ECO:0000250|UniProtKB:P07901} 272..617 276/345 (80%)
Interaction with FLCN and FNIP1. {ECO:0000250|UniProtKB:P07900} 285..733 352/450 (78%)
Interaction with FNIP2 and TSC1. {ECO:0000250|UniProtKB:P07900} 285..621 270/336 (80%)
Interaction with NR1D1. {ECO:0000250|UniProtKB:P07901} 629..732 75/105 (71%)
Required for homodimerization. {ECO:0000250|UniProtKB:P07900} 683..733 32/52 (62%)
TPR repeat-binding. {ECO:0000250|UniProtKB:P07900} 724..733 6/9 (67%)
Essential for interaction with SMYD3, TSC1 and STIP1/HOP. {ECO:0000250|UniProtKB:P07900} 729..733 4/4 (100%)
Essential for interaction with SGTA and TTC1. {ECO:0000250|UniProtKB:P07900} 730..733 3/3 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C70463389
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000421
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11528
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.040

Return to query results.
Submit another query.