DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hsp83 and hsp90

Sequence 1:NP_001261362.1 Gene:Hsp83 FlyBaseID:FBgn0001233 Length:717 Species:Drosophila melanogaster
Sequence 2:NP_594365.1 Gene:hsp90 PomBaseID:SPAC926.04c Length:704 Species:Schizosaccharomyces pombe

Alignment Length:715 Identity:445/716 (62%)
Similarity:563/716 (79%) Gaps:18/716 (3%)


  Fly     6 ETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNASDALDKIRYESLTDPSKLDSGKELYIKLIP 70
            |||.|:|||:|||||||||.||||||||||||||||||||||||:||:||..||:.|:|:|::.|
pombe     5 ETFKFEAEISQLMSLIINTVYSNKEIFLRELISNASDALDKIRYQSLSDPHALDAEKDLFIRITP 69

  Fly    71 NKTAGTLTIIDTGIGMTKSDLVNNLGTIAKSGTKAFMEALQAGADISMIGQFGVGFYSAYLVADK 135
            :|....|:|.||||||||:||:||||.|||||||.||||..:|||||||||||||||||||||||
pombe    70 DKENKILSIRDTGIGMTKNDLINNLGVIAKSGTKQFMEAAASGADISMIGQFGVGFYSAYLVADK 134

  Fly   136 VTVTSKNNDDEQYVWESSAGGSFTVRADNSEP-LGRGTKIVLYIKEDQTDYLEESKIKEIVNKHS 199
            |.|.||:||||||:|||||||||||..|...| |.|||:|.|::||||..||||..||:.|.|||
pombe   135 VQVVSKHNDDEQYIWESSAGGSFTVTLDTDGPRLLRGTEIRLFMKEDQLQYLEEKTIKDTVKKHS 199

  Fly   200 QFIGYPIKLLVEKEREKEVSDDEADDE-KKEGDEKKEMETDEPKIEDVGEDEDADKKDKDAKKKK 263
            :||.|||:|:|.:|.||||.::|..:| |.|.|:|      .||||:|  |::::||:|..||  
pombe   200 EFISYPIQLVVTREVEKEVPEEEETEEVKNEEDDK------APKIEEV--DDESEKKEKKTKK-- 254

  Fly   264 TIKEKYTEDEELNKTKPIWTRNPDDISQEEYGEFYKSLTNDWEDHLAVKHFSVEGQLEFRALLFI 328
             :||..||.||||||||||||||.::::|||..||||||||||||||||||||||||||||:||:
pombe   255 -VKETTTETEELNKTKPIWTRNPSEVTKEEYASFYKSLTNDWEDHLAVKHFSVEGQLEFRAILFV 318

  Fly   329 PRRTPFDLFENQKKRNNIKLYVRRVFIMDNCEDLIPEYLNFMKGVVDSEDLPLNISREMLQQNKV 393
            |||.|.||||.::|:||||||||||||.|:||:||||:|.|:||||||||||||:|||||||||:
pombe   319 PRRAPMDLFEAKRKKNNIKLYVRRVFITDDCEELIPEWLGFIKGVVDSEDLPLNLSREMLQQNKI 383

  Fly   394 LKVIRKNLVKKTMELIEELTEDKENYKKFYDQFSKNLKLGVHEDSNNRAKLADFLRFHTSASGDD 458
            :||||||||::.:::..|:.|||||:|.|||.||||||||:|||:.||..||..||:::..|.||
pombe   384 MKVIRKNLVRRCLDMFNEIAEDKENFKTFYDAFSKNLKLGIHEDAANRPALAKLLRYNSLNSPDD 448

  Fly   459 FCSLADYVSRMKDNQKHVYFITGESKDQVSNSAFVERVKARGFEVVYMTEPIDEYVIQHLKEYKG 523
            ..||.||:::|.::||::||||||||..|.||.|:|..:|:.|:|::|.:|||||.:..|||::|
pombe   449 LISLEDYITKMPEHQKNIYFITGESKQAVENSPFLEIFRAKKFDVLFMVDPIDEYAVTQLKEFEG 513

  Fly   524 KQLVSVTKEGLELPEDESEKKKREEDKAKFESLCKLMKSILDNKVEKVVVSNRLVDSPCCIVTSQ 588
            |:||::||:||||.|.:.||..||:.:.::|...|.:|:||.:|||||||||::|.|||.:.|.|
pombe   514 KKLVNITKDGLELEETDEEKAAREKLEKEYEEFAKQLKTILGDKVEKVVVSNKIVGSPCLLTTGQ 578

  Fly   589 FGWSANMERIMKAQALRDTATMGYMAGKKQLEINPDHPIVETLRQKADAD-KNDKAVKDLVILLF 652
            :||||||||||||||||||:...||:.:|..||||..||:..|::|.:.: ..|::||||..:|:
pombe   579 YGWSANMERIMKAQALRDTSMSAYMSSRKTFEINPKSPIIAELKKKVEENGAEDRSVKDLATILY 643

  Fly   653 ETSLLSSGFSLDSPQVHASRIYRMIKLGLGIDEDEPMTTDDAQSAGDAPSLVEDTEDASHMEEVD 717
            ||:||||||:||.|..:|.||.|:|.|||.|||:|....::..:    .|:..:....|.|||||
pombe   644 ETALLSSGFTLDDPSAYAQRINRLISLGLSIDEEEEAPIEEIST----ESVAAENNAESKMEEVD 704

  Fly   718  717
            pombe   705  704

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Hsp83NP_001261362.1 PTZ00272 6..717 CDD:240341 444/714 (62%)
HATPase_c 28..179 CDD:214643 112/152 (74%)
HSP90 184..706 CDD:278607 305/524 (58%)
hsp90NP_594365.1 PTZ00272 4..704 CDD:240341 444/714 (62%)
HATPase_c 29..161 CDD:238030 102/132 (77%)
HSP90 185..704 CDD:278607 310/534 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 1 1.000 H74306
Inparanoid 1 1.050 879 1.000 Inparanoid score I51
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000421
OrthoInspector 1 1.000 T1124408
orthoMCL 1 0.900 OOG5_126623
Panther 1 1.100 LDO PTHR11528
Phylome 1 0.910 0.933 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R576
TreeFam 1 0.960
1110.960

Return to query results.
Submit another query.