DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hsp83 and enpl-1

Sequence 1:NP_001261362.1 Gene:Hsp83 FlyBaseID:FBgn0001233 Length:717 Species:Drosophila melanogaster
Sequence 2:NP_001255536.1 Gene:enpl-1 WormBaseID:WBGene00011480 Length:760 Species:Caenorhabditis elegans

Alignment Length:725 Identity:326/726 (45%)
Similarity:469/726 (65%) Gaps:39/726 (5%)


  Fly     4 EAETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNASDALDKIRYESLTDPSKLDSGKELYIKL 68
            :||...||||:.::|.||||:.|.|||||||||||||||||||||..|||||.:|...:|:.:|:
 Worm    60 KAEKHEFQAEVNRMMKLIINSLYRNKEIFLRELISNASDALDKIRLLSLTDPEQLRETEEMSVKI 124

  Fly    69 IPNKTAGTLTIIDTGIGMTKSDLVNNLGTIAKSGTKAFMEALQAGADIS-----MIGQFGVGFYS 128
            ..::....|.|.|||:|||:.||:|||||||:|||..|:..|...|..|     :|||||||||:
 Worm   125 KADRENRLLHITDTGVGMTRQDLINNLGTIARSGTSEFLSKLMDTATSSDQQQDLIGQFGVGFYA 189

  Fly   129 AYLVADKVTVTSKNNDDEQYVWESSAGGSFTVRAD-NSEPLGRGTKIVLYIKEDQTDYLEESKIK 192
            |:||||:|.||:|||||:||:|||.: .|||:..| ....|.|||:|.||:||:..|:||...:|
 Worm   190 AFLVADRVVVTTKNNDDDQYIWESDS-ASFTISKDPRGNTLKRGTQITLYLKEEAADFLEPDTLK 253

  Fly   193 EIVNKHSQFIGYPIKLLVEKEREKEVSDDEADDEKKEGDEKKEMETDEPKIEDVGEDEDADKKDK 257
            .:|:|:||||.:.|.|...|....|           |..|::...|::..:|:          :|
 Worm   254 NLVHKYSQFINFDIFLWQSKTEMVE-----------EAVEEEPATTEDGAVEE----------EK 297

  Fly   258 DAKKKKTIKEKYTED-EELNKTKPIWTRNPDDISQEEYGEFYKSLTNDWEDHLAVKHFSVEGQLE 321
            :.||.|.: ||.|.| |::|..||||.|.|:.:.::||.:||||:|.|.|:.|:..|||.||::.
 Worm   298 EEKKTKKV-EKTTWDWEKVNNVKPIWMRKPNQVEEDEYKQFYKSITKDSEEPLSHVHFSAEGEVS 361

  Fly   322 FRALLFIPRRTPFDLFENQ-KKRNNIKLYVRRVFIMDNCEDLIPEYLNFMKGVVDSEDLPLNISR 385
            ||::|::|:::|.|:|:|. |...|||||||||||.|:..|::|:||:|::|:|||:|||||:||
 Worm   362 FRSILYVPKKSPNDMFQNYGKVIENIKLYVRRVFITDDFADMLPKYLSFIRGIVDSDDLPLNVSR 426

  Fly   386 EMLQQNKVLKVIRKNLVKKTMELIEELTEDKENYKKFYDQFSKNLKLGVHEDSNNRAKLADFLRF 450
            |.|||:|:||||:|.||:|.::::::|  |...:..|:.:||.|:||||.||.:||.:||..|||
 Worm   427 ENLQQHKLLKVIKKKLVRKVLDMLKKL--DGAQFDDFWSEFSTNIKLGVMEDPSNRMRLAKLLRF 489

  Fly   451 HTSASGDDFCSLADYVSRMKDNQKHVYFITGESKDQVSNSAFVERVKARGFEVVYMTEPIDEYVI 515
            .:|...|...:||.||.|||:.|..:|::.|.|:.:|..|.||||:.|:|:||:::||.:|||.|
 Worm   490 QSSNDADKTTTLAAYVERMKEKQDAIYYMAGTSRKEVETSPFVERLIAKGYEVLFLTEAVDEYCI 554

  Fly   516 QHLKEYKGKQLVSVTKEGLELPEDESEKKKREEDKAKFESLCKLMK-SILDNKVEKVVVSNRLVD 579
            |.:.||:.|:..:|.|||:.:.:.|..|:..:..:.:|:.|...:| :.|.:.:||.|||.|||.
 Worm   555 QAMPEYESKKFQNVAKEGVTIDDGEKAKEAHKGLEEEFKPLTDWLKETALKDLIEKAVVSQRLVK 619

  Fly   580 SPCCIVTSQFGWSANMERIMKAQA---LRDTATMGYMAGKKQLEINPDHPIVETLRQKADADKND 641
            ||..:|.|.:|||.|||||||:||   .:|.....|...||..||||.||:::.|.::..|.:.|
 Worm   620 SPSALVASSYGWSGNMERIMKSQAYAKAKDPTQDFYATQKKTFEINPRHPVIKELLKRVTASEED 684

  Fly   642 KAVKDLVILLFETSLLSSGFSLDSPQVHASRIYRMIKLGLGIDEDEPMTTDD-AQSAGDAPSLVE 705
            ........|||||:.|.|||||......|.||..:::..|.:.:|..:.|:. .:.|...|...|
 Worm   685 TTAASTAKLLFETATLRSGFSLQDQVGFADRIEAVLRQSLDVSQDAQVETEQHIEEAEPEPEAAE 749

  Fly   706 DTE-DASHME 714
            :|. :..|.|
 Worm   750 ETTIEEEHSE 759

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Hsp83NP_001261362.1 PTZ00272 6..717 CDD:240341 325/724 (45%)
HATPase_c 28..179 CDD:214643 91/157 (58%)
HSP90 184..706 CDD:278607 218/529 (41%)
enpl-1NP_001255536.1 PRK05218 59..724 CDD:235366 317/689 (46%)
HATPase_c 84..242 CDD:214643 93/159 (58%)
HSP90 245..735 CDD:278607 215/514 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D174605at33208
OrthoFinder 1 1.000 FOG0000421
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126623
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.