DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hsp83 and LOC103692716

Sequence 1:NP_001261362.1 Gene:Hsp83 FlyBaseID:FBgn0001233 Length:717 Species:Drosophila melanogaster
Sequence 2:XP_008763191.1 Gene:LOC103692716 RGDID:9292348 Length:733 Species:Rattus norvegicus

Alignment Length:721 Identity:572/722 (79%)
Similarity:646/722 (89%) Gaps:8/722 (1%)


  Fly     3 EEAETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNASDALDKIRYESLTDPSKLDSGKELYIK 67
            ||.||||||||||||||||||||||||||||||||||:||||||||||||||||||||||||:|.
  Rat    15 EEVETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNSSDALDKIRYESLTDPSKLDSGKELHIN 79

  Fly    68 LIPNKTAGTLTIIDTGIGMTKSDLVNNLGTIAKSGTKAFMEALQAGADISMIGQFGVGFYSAYLV 132
            |||||...||||:||||||||:||:||||||||||||||||||||||||||||||||||||||||
  Rat    80 LIPNKQDRTLTIVDTGIGMTKADLINNLGTIAKSGTKAFMEALQAGADISMIGQFGVGFYSAYLV 144

  Fly   133 ADKVTVTSKNNDDEQYVWESSAGGSFTVRADNSEPLGRGTKIVLYIKEDQTDYLEESKIKEIVNK 197
            |:||||.:|:||||||.||||||||||||.|..||:|||||::|::|||||:||||.:|||||.|
  Rat   145 AEKVTVITKHNDDEQYAWESSAGGSFTVRTDTGEPMGRGTKVILHLKEDQTEYLEERRIKEIVKK 209

  Fly   198 HSQFIGYPIKLLVEKEREKEVSDDEAD--DEKKEGDEKKEMETDE-PKIEDVGED-EDADKKDKD 258
            |||||||||.|.|||||:||||||||:  :||:|..||:|.|:|: |:|||||.| |:.:|||.|
  Rat   210 HSQFIGYPITLFVEKERDKEVSDDEAEEKEEKEEEKEKEEKESDDKPEIEDVGSDEEEEEKKDGD 274

  Fly   259 AKKKKTIKEKYTEDEELNKTKPIWTRNPDDISQEEYGEFYKSLTNDWEDHLAVKHFSVEGQLEFR 323
            .||||.|||||.:.|||||||||||||||||:.|||||||||||||||:||||||||||||||||
  Rat   275 KKKKKKIKEKYIDQEELNKTKPIWTRNPDDITNEEYGEFYKSLTNDWEEHLAVKHFSVEGQLEFR 339

  Fly   324 ALLFIPRRTPFDLFENQKKRNNIKLYVRRVFIMDNCEDLIPEYLNFMKGVVDSEDLPLNISREML 388
            ||||:|||.|||||||:||:|||||||||||||||||:||||||||::|||||||||||||||||
  Rat   340 ALLFVPRRAPFDLFENRKKKNNIKLYVRRVFIMDNCEELIPEYLNFIRGVVDSEDLPLNISREML 404

  Fly   389 QQNKVLKVIRKNLVKKTMELIEELTEDKENYKKFYDQFSKNLKLGVHEDSNNRAKLADFLRFHTS 453
            ||:|:|||||||||||.:||..||.||||||||||:|||||:|||:||||.||.||::.||::||
  Rat   405 QQSKILKVIRKNLVKKCLELFTELAEDKENYKKFYEQFSKNIKLGIHEDSQNRKKLSELLRYYTS 469

  Fly   454 ASGDDFCSLADYVSRMKDNQKHVYFITGESKDQVSNSAFVERVKARGFEVVYMTEPIDEYVIQHL 518
            ||||:..||.||.:|||:||||:||||||:||||:|||||||::..|.||:||.||||||.:|.|
  Rat   470 ASGDEMVSLKDYCTRMKENQKHIYFITGETKDQVANSAFVERLRKHGLEVIYMIEPIDEYCVQQL 534

  Fly   519 KEYKGKQLVSVTKEGLELPEDESEKKKREEDKAKFESLCKLMKSILDNKVEKVVVSNRLVDSPCC 583
            ||::||.|||||||||||||||.||||:||.|.|||:|||:||.||:.||||||||||||.||||
  Rat   535 KEFEGKTLVSVTKEGLELPEDEEEKKKQEEKKTKFENLCKIMKDILEKKVEKVVVSNRLVTSPCC 599

  Fly   584 IVTSQFGWSANMERIMKAQALRDTATMGYMAGKKQLEINPDHPIVETLRQKADADKNDKAVKDLV 648
            ||||.:||:||||||||||||||.:||||||.||.|||||||.|:|||||||:||||||:|||||
  Rat   600 IVTSTYGWTANMERIMKAQALRDNSTMGYMAAKKHLEINPDHSIIETLRQKAEADKNDKSVKDLV 664

  Fly   649 ILLFETSLLSSGFSLDSPQVHASRIYRMIKLGLGIDEDEPMTTDDAQSA--GDAPSLVEDTEDAS 711
            |||:||:||||||||:.||.||:|||||||||||||||:| |.||..:|  .:.|.| |..:|.|
  Rat   665 ILLYETALLSSGFSLEDPQTHANRIYRMIKLGLGIDEDDP-TVDDTSAAVTEEMPPL-EGDDDTS 727

  Fly   712 HMEEVD 717
            .|||||
  Rat   728 RMEEVD 733

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Hsp83NP_001261362.1 PTZ00272 6..717 CDD:240341 569/717 (79%)
HATPase_c 28..179 CDD:214643 129/151 (85%)
HSP90 184..706 CDD:278607 407/528 (77%)
LOC103692716XP_008763191.1 PTZ00272 18..733 CDD:240341 569/717 (79%)
HATPase_c 40..191 CDD:214643 129/151 (85%)
HSP90 196..723 CDD:278607 407/529 (77%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C70471886
eggNOG 1 0.900 E1_COG0326
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 1144 1.000 Inparanoid score I197
OMA 1 1.010
OrthoDB 1 1.010 D174605at33208
OrthoFinder 1 1.000 FOG0000421
OrthoInspector 1 1.000 T617668
orthoMCL 1 0.900 OOG5_126623
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.933 Consistency score
TreeFam 1 0.960
1110.670

Return to query results.
Submit another query.