DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14958 and CG13309

DIOPT Version :8

Sequence 1:NP_647782.1 Gene:CG14958 / 38387 FlyBaseID:FBgn0035413 Length:145 Species:Drosophila melanogaster
Sequence 2:NP_648262.2 Gene:CG13309 / 39012 FlyBaseID:FBgn0035933 Length:229 Species:Drosophila melanogaster

Alignment Length:134 Identity:49/135 (36%)
Similarity:71/135 (53%) Gaps:6/135 (4%)


  Fly     4 LLGLIALVAFPIAWIQADCNVCQSNGASCINQTAYNLCFGSTQPNTNQTFVCTDGLVCTDQPVIC 68
            :|.|:.::.|.|...:|.||.|.:||.|||::|.:..|..:::|..| .:.|..|..||:...||
  Fly     1 MLRLLIVLGFYILGCRAACNTCNANGVSCISETEFQFCSSASEPIGN-LYTCPTGYYCTESTPIC 64

  Fly    69 FQRGENPASCGDTDSCGQCAPNYTFACTSRSTFAFCFGAITP-TNVTGSCPDGYFCDASTQEICV 132
                .:.||......|..|:.:..||||.|:|||.|.|..|| |::.|||...|.|:.....||.
  Fly    65 ----SSVASSAGCTGCNTCSSDNRFACTGRNTFALCLGTSTPSTSIGGSCGTNYVCNVGNANICG 125

  Fly   133 TKAT 136
            :.||
  Fly   126 SPAT 129



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C4872105
eggNOG 1 0.900 E1_2F9QR
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.