DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14958 and CG13312

DIOPT Version :8

Sequence 1:NP_647782.1 Gene:CG14958 / 38387 FlyBaseID:FBgn0035413 Length:145 Species:Drosophila melanogaster
Sequence 2:NP_648260.1 Gene:CG13312 / 39010 FlyBaseID:FBgn0035931 Length:342 Species:Drosophila melanogaster

Alignment Length:153 Identity:46/154 (30%)
Similarity:61/154 (40%) Gaps:29/154 (19%)


  Fly     7 LIALVAFPIAWIQADCNVCQSNGASCINQTAYNL-CFGSTQPNTNQTFV--------CTDGLVCT 62
            |:.|:...::.....||||         .|..|| |:.|||..:.|..|        |..|.||.
  Fly    15 LLFLLGCLVSSTHGTCNVC---------NTVNNLTCYSSTQMQSCQVDVLSTATPTDCPSGYVCV 70

  Fly    63 --DQPVICFQRGENPASCGDTDSCGQCAPNYTFACTSRSTFAFCFGAITPTNVTGSCPDGYFCDA 125
              ...|:|........|..|...|.:|....|||||...:||.|.|..|..:..|:|..||.|:.
  Fly    71 SGSSGVLCQPEDSASDSQADCQECNKCDETQTFACTGTQSFALCLGTDTVQDSVGTCASGYVCNI 135

  Fly   126 STQEICVTKA---------TDDS 139
            :..:||...|         :|||
  Fly   136 NDTQICGLPADGVMPTCSYSDDS 158



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C4872142
eggNOG 1 0.900 E1_2F9QR
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.