| Sequence 1: | NP_647782.1 | Gene: | CG14958 / 38387 | FlyBaseID: | FBgn0035413 | Length: | 145 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_648260.1 | Gene: | CG13312 / 39010 | FlyBaseID: | FBgn0035931 | Length: | 342 | Species: | Drosophila melanogaster |
| Alignment Length: | 153 | Identity: | 46/153 - (30%) |
|---|---|---|---|
| Similarity: | 61/153 - (39%) | Gaps: | 29/153 - (18%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 7 LIALVAFPIAWIQADCNVCQSNGASCINQTAYNL-CFGSTQPNTNQTFV--------CTDGLVCT 62
Fly 63 --DQPVICFQRGENPASCGDTDSCGQCAPNYTFACTSRSTFAFCFGAITPTNVTGSCPDGYFCDA 125
Fly 126 STQEICVTKA---------TDDS 139 |
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 1 | 0.930 | - | - | C45471618 | |
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_2F9QR | |
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 1 | 1.000 | - | - | FOG0005298 | |
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| 4 | 3.740 | |||||