DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14958 and CG13311

DIOPT Version :8

Sequence 1:NP_647782.1 Gene:CG14958 / 38387 FlyBaseID:FBgn0035413 Length:145 Species:Drosophila melanogaster
Sequence 2:NP_648258.1 Gene:CG13311 / 39008 FlyBaseID:FBgn0035929 Length:153 Species:Drosophila melanogaster

Alignment Length:144 Identity:54/145 (37%)
Similarity:69/145 (48%) Gaps:12/145 (8%)


  Fly     5 LGLIALVAFPIAWIQADCNVCQSNGASCINQTAYNLCFGSTQPNTNQTFVCTDGLVCTDQPVICF 69
            |.||.:|:.....:|..||.||:|...|:|:|.|:.|..:..|  ||...|.|..||||..:||.
  Fly    10 LCLIVVVSSMAVLVQGVCNSCQANNVKCLNETHYSFCSDNVAP--NQVLQCPDNKVCTDLAIICM 72

  Fly    70 QRGENPASCGDT--DSCGQCAPNYTFACTSRSTFAFCFGAITPTNVTG---SCPDGYFCDASTQE 129
            ......:||..|  .||..|..|..|.||||:||..|.|    ||:||   .|.|...|...:.:
  Fly    73 DSSVVDSSCSGTADGSCPTCDGNSMFVCTSRTTFQMCDG----TNLTGQVTKCKDNKICSIKSGK 133

  Fly   130 ICVTKA-TDDSIIC 142
            .||... ..||:.|
  Fly   134 YCVDLCEVGDSVEC 147



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C4871841
eggNOG 1 0.900 E1_2F9QR
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.