Sequence 1: | NP_647782.1 | Gene: | CG14958 / 38387 | FlyBaseID: | FBgn0035413 | Length: | 145 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_648258.1 | Gene: | CG13311 / 39008 | FlyBaseID: | FBgn0035929 | Length: | 153 | Species: | Drosophila melanogaster |
Alignment Length: | 144 | Identity: | 54/144 - (37%) |
---|---|---|---|
Similarity: | 69/144 - (47%) | Gaps: | 12/144 - (8%) |
- Green bases have known domain annotations that are detailed below.
Fly 5 LGLIALVAFPIAWIQADCNVCQSNGASCINQTAYNLCFGSTQPNTNQTFVCTDGLVCTDQPVICF 69
Fly 70 QRGENPASCGDT--DSCGQCAPNYTFACTSRSTFAFCFGAITPTNVTG---SCPDGYFCDASTQE 129
Fly 130 ICVTKA-TDDSIIC 142 |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C45471593 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_2F9QR | |
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0005298 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
4 | 3.740 |