DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG14964 and IGFN1

Sequence 1:NP_647779.2 Gene:CG14964 FlyBaseID:FBgn0035410 Length:1443 Species:Drosophila melanogaster
Sequence 2:NP_001158058.1 Gene:IGFN1 HGNCID:24607 Length:3708 Species:Homo sapiens

Alignment Length:669 Identity:150/670 (22%)
Similarity:234/670 (35%) Gaps:177/670 (26%)


  Fly    13 QGGRPKKNVHWKSAERPSPPGRPILTPVALPEQQPDVVNLRWDRPLHDGGSPITGYTVEHRRMGS 77
            :||..:..:..:..::|.||    ..|:.:.:.....|.|||..|..:||..:..|.||.|:.|.
Human  3085 EGGSVQAELTLQVIDKPDPP----QGPMEVQDCHRAGVCLRWRPPRDNGGRTVECYVVERRQAGR 3145

  Fly    78 PHWVRATPTPVDRCDVCISGLEPGWRYQFRCFAENIVGRSDASEL--------------SDPLTV 128
            ..|::....|.|......:.:|||.:|.||..|....|..:|.|.              |.|..:
Human  3146 STWLKVGEAPADSTTFTDAHVEPGRKYTFRVRAVTSEGAGEALESEEILVAPEALPKAPSAPAIL 3210

  Fly   129 TLQRNAITV----PR------FIDELVDT--------NAVEDERI----------------EFRV 159
            :.....||:    ||      .:..|::.        .||.|:.:                ||||
Human  3211 SASSQGITLTWTAPRGPGSAHILGYLIERRKKGSNTWTAVNDQPVPERRWTVADVRQGCQYEFRV 3275

  Fly   160 RIL-----GEPPPEINWFKDGYEIFSS---------RRTKIVNDNEASVLVIHQVALTDEGE--- 207
            ..:     |||.|..:      .:|:.         |..::.:.:..|:.:......|.||:   
Human  3276 TAVAPSGPGEPGPPSD------AVFARDPMRPPGLVRNLQVTDRSNTSITLSWAGPDTQEGDEAQ 3334

  Fly   208 ---------------------------------------IKCTATNRAGHVITKA-RLMVQAP-- 230
                                                   ::.||.|..|.....| ..:|||.  
Human  3335 GYVVELCSSDSLQWLPCHVGTVPVTTYTAKGLRPGEGYFVRVTAVNEGGQSQPSALDTLVQAMPV 3399

  Fly   231 ---PKIRLPRTYEDGLIVEADEVLRLKVGVAGQPPPAITWLHEGEVIAPGGRFEVSNTEKNSL-- 290
               ||..:..:.:|.|.|:..:.:|:.|.....|.|.:|||.:|   .|..:..|:.| |:.|  
Human  3400 TVCPKFLVDSSTKDLLTVKVGDTVRVPVSFEAMPMPEVTWLKDG---LPLPKRSVTVT-KDGLTQ 3460

  Fly   291 LKIDNVLREDRGEYMVKAWNRLGED-STSFLVTVTARPNPPGTPKLNMSFGKSATLSWTAPLDDG 354
            |.|......|.|.|.|......|:: :.||.:.|.|.|..||...|..:...:.|..|....|:.
Human  3461 LLIPVAGLSDSGLYTVVLRTLQGKEVAHSFRIRVAACPQAPGPIHLQENVPGTVTAEWEPSPDEA 3525

  Fly   355 GCKIGNYIVEYFRVGWNVWLKAA----TTRALSTTLHDLIEGSEYKFRVKAENPYGLSEPSGESE 415
            .....:|.|.........|.:||    |.|   .||..::.|.||.|||.|:|..|.|:||..|:
Human  3526 QDVPLHYAVFTRSSAHGPWHEAADRIHTNR---FTLLGILPGHEYHFRVVAKNELGASKPSDTSQ 3587

  Fly   416 LLFIPDPKRGITKPKSATRIAGDEKDKPKTGAGGMQVPPRRKTLSPPRPQADASTGMSPKQSPSA 480
            ...||..:...|......| ..|...||:...|      .|..|.|        .|.....|.:.
Human  3588 PWCIPRQRDRFTVKAPCYR-EPDLSQKPRFLVG------LRSHLLP--------QGCECCMSCAV 3637

  Fly   481 KRKPKPQLIDNEQLTHEMSYGTSDHALKMDVRKSPSLNSAD--SANKPTTDSSNPK--------- 534
            :..|:|          .:::..:|.:|:    .:|::.|.|  .....|..|.:||         
Human  3638 QGSPRP----------HVTWFKNDRSLE----GNPAVYSTDLLGVCSLTIPSVSPKDSGEYKAVA 3688

  Fly   535 ---LNLTLVTTTLAPLDKS 550
               |...:.|.||..::.|
Human  3689 ENTLGQAVSTATLIVIEPS 3707

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14964NP_647779.2 FN3 29..127 CDD:238020 31/112 (28%)
I-set 138..227 CDD:254352 25/176 (14%)
Ig 155..224 CDD:143165 19/142 (13%)
IG_like 243..323 CDD:214653 24/83 (29%)
Ig 250..323 CDD:299845 22/76 (29%)
FN3 327..411 CDD:238020 27/88 (31%)
IGFN1NP_001158058.1 I-set 29..120 CDD:254352
Ig 46..120 CDD:299845
I-set 309..395 CDD:254352
I-set 2914..2997 CDD:254352
Ig 2930..2998 CDD:143165
I-set 3005..3097 CDD:254352 2/12 (17%)
Ig 3017..3104 CDD:299845 4/19 (21%)
FN3 3101..3193 CDD:238020 29/96 (30%)
FN3 3201..3278 CDD:238020 14/77 (18%)
FN3 3302..3388 CDD:238020 9/86 (10%)
IG_like 3415..3494 CDD:214653 24/83 (29%)
Ig 3422..3494 CDD:299845 22/76 (29%)
FN3 3498..3587 CDD:238020 29/92 (32%)
I-set 3614..3703 CDD:254352 22/117 (19%)
Ig 3633..3700 CDD:143165 14/81 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG0613
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.