DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG14964 and mybpc2b

Sequence 1:NP_647779.2 Gene:CG14964 FlyBaseID:FBgn0035410 Length:1443 Species:Drosophila melanogaster
Sequence 2:NP_001013529.2 Gene:mybpc2b ZFINID:ZDB-GENE-050320-80 Length:1111 Species:Danio rerio

Alignment Length:580 Identity:147/581 (25%)
Similarity:231/581 (40%) Gaps:90/581 (15%)


  Fly    10 THPQGGRPKKNVHWKSAERPSPPGRPILTPVALPEQQPDVVNLRWDRPLHDGGSPITGYTVEHRR 74
            |:| .|..|.|:..|..:.|.||.....|.|.     .|..|:.||.|..|||:|:.||.:|.::
Zfish   586 TNP-AGEDKANLFIKIVDVPDPPENVKCTGVG-----EDTANIVWDPPKFDGGAPLKGYLMERKK 644

  Fly    75 MGSPHWVRATPTPVDRCDVCISGLEPGWRYQFRCFAENIVGRSDASELSD---PLTVTLQRNAIT 136
            .||..|.:......:........:..|..|:.|.||.|.:|.|..|..|.   |:..|.:...:|
Zfish   645 KGSSRWTKLNFDVYESTTYEAKRMIEGILYEMRVFAVNGIGISAPSLNSKPFMPIAPTSEPTKLT 709

  Fly   137 VPRFIDELVDTNAVEDERIEFRVRILGEPPPEINWFKDGYEIFSSRRTKIVNDNEASVLVIHQVA 201
            |    |::.||..........::...|.....|.:.|:|...:....|.:|   |....|:..:.
Zfish   710 V----DDVTDTTCSLKWLAPEKIGAGGLDGYIIEFCKEGESEWHPANTDLV---ERQSFVVRNLP 767

  Fly   202 LTDEGEIKCTATNRA--------GHVITKARLMVQAPPKIRLPRTYEDGLIVEADEVLRLKVGVA 258
            ..::...:..|.|.|        |..:|...:|..  |||||||......|....|.:.|.:...
Zfish   768 TGEKMNFRVVAVNIAGRSPPALLGQPVTVREIMEH--PKIRLPRDLRTKYIRRVGEKINLVIPFQ 830

  Fly   259 GQPPPAITWLHEGEVIAPGGRFEVSNTEKNSLLKIDNVLREDRGEYMVKAWNRLGEDSTSFLVTV 323
            |:|.|..|||.:|:.: ...:..|.|:..:|:|.|....|:..|:|.:.......|||.:..:.:
Zfish   831 GKPRPIATWLKDGQPV-DEKKVGVRNSNVDSILFIRAAERDHSGKYTLTLKIENMEDSATIEIRI 894

  Fly   324 TARPNPPGTPKLNMSFGKSATLSWTAPLDDGGCKIGNYIVEYFRVGWNVWLKA-ATTRALSTTLH 387
            ..:|.||....:...:|.:|.|.|..|.|||.|:|..|.::........|... ...|..:.|:.
Zfish   895 VDKPGPPIGVHVTDVWGFNAALEWKPPKDDGNCEITGYTIQKAEKKTKEWFTVYEHNRRTNCTVS 959

  Fly   388 DLIEGSEYKFRVKAENPYGLSEPS---------GESELLFIPDPKRGITKPKSATRIAGDEKDKP 443
            |||.|:||.|||.:||..||||..         .:|.|.:.|.|.:              |||  
Zfish   960 DLIIGNEYMFRVYSENLCGLSEDPCMSKNNAIISKSGLDYKPPPYK--------------EKD-- 1008

  Fly   444 KTGAGGMQVPPRRKTLSPPRPQADASTGMSPKQSPSAKRKPKPQLI---------DNEQLTHEMS 499
                  |...|:   .:.|......:.|.|...|.:.:..|||::|         |:.:...:.:
Zfish  1009 ------MNCAPK---FTAPLVDRAVTIGYSTAISCAVRAFPKPKIIWMKNKMIIGDDPKFLMQNN 1064

  Fly   500 YGTSDHALKMDVRKSPSLNSAD----SANKPTTDSSNPKLNLTLVTTTLAPLDKSVPSPK 555
            .|    .|.:::||..:.:|..    :.|:...|....||.:           |::|:.|
Zfish  1065 QG----VLTLNIRKPSTFDSGKYSCRAVNELGEDEVECKLEI-----------KAIPTEK 1109

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14964NP_647779.2 FN3 29..127 CDD:238020 31/101 (31%)
I-set 138..227 CDD:254352 17/97 (18%)
Ig 155..224 CDD:143165 13/77 (17%)
IG_like 243..323 CDD:214653 21/80 (26%)
Ig 250..323 CDD:299845 19/73 (26%)
FN3 327..411 CDD:238020 32/85 (38%)
mybpc2bNP_001013529.2 IG_like 33..128 CDD:214653
I-set 223..306 CDD:254352
Ig 224..295 CDD:299845
IG_like 319..398 CDD:214653
Ig 420..>473 CDD:143165
Ig_C5_MyBP-C 515..600 CDD:143302 6/15 (40%)
IG_like 518..600 CDD:214653 6/15 (40%)
FN3 604..690 CDD:238020 28/91 (31%)
FN3 703..795 CDD:238020 17/99 (17%)
I-set 803..891 CDD:254352 28/89 (31%)
Ig_Titin_like 822..894 CDD:143225 19/73 (26%)
FN3 898..981 CDD:238020 31/83 (37%)
I-set 1013..1102 CDD:254352 19/96 (20%)
Ig 1032..1097 CDD:143165 13/69 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000617
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.