DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG14964 and Mybph

Sequence 1:NP_647779.2 Gene:CG14964 FlyBaseID:FBgn0035410 Length:1443 Species:Drosophila melanogaster
Sequence 2:XP_006529816.1 Gene:Mybph MGIID:1858196 Length:490 Species:Mus musculus

Alignment Length:553 Identity:123/554 (22%)
Similarity:189/554 (34%) Gaps:176/554 (32%)


  Fly    25 SAERPSPPGRPILTP---VALPEQQPDVVNLRWDRPLHDGGSPITGYTVEHRRMGSPHWVRATPT 86
            :|.:|.||...:.:.   :.|.:.....:.:.|:.|...|...:.||.:|..|.|:..||...|.
Mouse    65 AATKPEPPSEDVPSAPLRLTLEDVSHSSLTVSWEPPEKLGKLGLQGYVLEFCREGASEWVPVNPR 129

  Fly    87 PVDRCDVCISGLEPGWRYQFRCFAENIVGRSDASELSDPLTVTLQRNAITVPRFIDELVDTNAVE 151
            ||                                      .||.|                    
Mouse   130 PV--------------------------------------MVTQQ-------------------- 136

  Fly   152 DERIEFRVRILGEPPPEINWFKDGYEIFSSRRTKIVNDNEASVLVIHQVALTDEGEIKCTATNRA 216
                                                        .:..:||.|:..::.||.:.|
Mouse   137 --------------------------------------------TVRNLALGDKFFLRVTAVSSA 157

  Fly   217 G-----------HV--ITKARLMVQAPPKIRLPRTYEDGLIVEADEVLRLKVGVAGQPPPAITWL 268
            |           |:  ||:|       ||||:||......|.:..|.:.|::...|:|.|.::|.
Mouse   158 GAGPPAVLDQPVHIQEITEA-------PKIRVPRHLRQTYIRQVGESVNLQIPFQGKPKPQVSWT 215

  Fly   269 HEGEVIAPGGRFEVSNTEKNSLLKIDNVLREDRGEYMVKAWNRLGEDSTSFLVTVTARPNPPGTP 333
            |.|..: ...|..|.:.:::|:|.|.:..|.|.|.|.:.......|...|..:.|..:|.||.:.
Mouse   216 HNGHAL-DNQRVNVRSGDQDSILFIRSAQRADSGRYELTVHLEGLEAKASIDILVIEKPGPPSSI 279

  Fly   334 KLNMSFGKSATLSWTAPLDDGGCKIGNYIVEYFRVGWNVWLKAATTRALST-TLHDLIEGSEYKF 397
            ||...:|.:|.|.||.|.|.|..::..|.|:........|.........:| |:.|||.|:.|.|
Mouse   280 KLLDVWGCNAALEWTPPQDTGNTELLGYTVQKADKRTGQWFTVLERYHPTTCTISDLIIGNSYSF 344

  Fly   398 RVKAENPYGLSE-PSGESELLFIPDPKRGIT-KPKSATRIAGDEKDKPKTGAGGMQVPPRRKTLS 460
            ||.:||..|||: .:...||..|  .|..|| ||:..  |..|..:.|                |
Mouse   345 RVFSENLCGLSDLATTTKELAHI--HKADITAKPREF--IERDFSEAP----------------S 389

  Fly   461 PPRPQAD--ASTGMSPKQSPSAKRKPKPQLIDNEQLTHEMSYGTSDHALKMDVRKSPSLNSADSA 523
            ..:|.||  ::.|.|.:...|.:..|||::|..:.              |||::..|...:....
Mouse   390 FTQPLADHTSTPGYSTQLFCSVRASPKPKIIWMKN--------------KMDIQGDPKYRAVSEQ 440

  Fly   524 NKPTTDSSNPKLNLTLVTTTLAPLDKSVPSPKA 556
            ...|.:...|           :|.|..|.:.||
Mouse   441 GVCTLEIRKP-----------SPFDSGVYTCKA 462

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14964NP_647779.2 FN3 29..127 CDD:238020 17/101 (17%)
I-set 138..227 CDD:254352 11/102 (11%)
Ig 155..224 CDD:143165 11/82 (13%)
IG_like 243..323 CDD:214653 20/80 (25%)
Ig 250..323 CDD:299845 18/73 (25%)
FN3 327..411 CDD:238020 31/86 (36%)
MybphXP_006529816.1 FN3 77..163 CDD:238020 24/188 (13%)
IG_like 188..269 CDD:214653 20/82 (24%)
Ig 197..269 CDD:299845 18/73 (25%)
FN3 273..361 CDD:238020 31/88 (35%)
I-set 388..477 CDD:254352 23/117 (20%)
Ig 407..471 CDD:143165 16/82 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000617
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.600 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.