DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14964 and Mybpc2

DIOPT Version :9

Sequence 1:NP_647779.2 Gene:CG14964 / 38384 FlyBaseID:FBgn0035410 Length:1443 Species:Drosophila melanogaster
Sequence 2:XP_038960733.1 Gene:Mybpc2 / 292879 RGDID:1311596 Length:1153 Species:Rattus norvegicus


Alignment Length:383 Identity:113/383 - (29%)
Similarity:162/383 - (42%) Gaps:59/383 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 EPGWRYQF-----RCFAENIVGRSDASELSDPLTVTLQRNAITVPRFIDELVDTNAVEDERIEFR 158
            |.|.|||.     :|.||.||.......|.|...:|::.:        ::.|....|.||::..:
  Rat   426 EDGGRYQVITNGGQCEAELIV
EEKQLEVLQDIADLTVKAS--------EQAVFKCEVSDEKVTGK 482

  Fly   159 VRILGEPPPEINWFKDGYEIFSSRRTKIVNDNEASVLVIHQVALTDEGEIKCTATNRAGHVITKA 223
                        |:|:|.|:..|:|..|.:......|||..|...|||:........|..:..|.
  Rat   483 ------------WYKNGVEVRPSKRITISHVGRFHKLVIDDVRPEDEGDYTFVPDGYALSLSAKL 535

  Fly   224 RLM--------VQAPPKIRLP---RTYEDGLIVEADEVLRLKVGVAGQPPPAITWLHEGEVIAPG 277
            ..:        .|.||||.|.   :|.::.::|.|...|||.|.:.|:|||..|||...||....
  Rat   536 NFLEIKVEYVPKQEPPKIHLDCSGKTSDNSIVVVAGNKLRLDVAITGEPPPTATWLKGDEVFTVS 600

  Fly   278 -GRFEVSNTEKNSLLKIDNVLREDRGEYMVKAWNRLGEDSTSFLVTVTARPNPPGTPKLNMSFGK 341
             ||..:......|...|::..|.|.|.|.:|..|..|||..|..:.|...|:||...::. |.|:
  Rat   601 EGRTRIEQRPDCSSFVIESAERSDEGRYTIKVTNPAGEDVASIFLRVVDVPDPPEAVRVT-SVGE 664

  Fly   342 S-ATLSWTAPLDDGGCKIGNYIVEYFRVGWNVWLKAATTRALSTTLHD--LIEGSEYKFRVKAEN 403
            . |.|.|..|..|||..:..|::|..:.|.:.|:|........||...  :|||..|:.||.|.|
  Rat   665 DWAILVWEPPKYDGGQPVTGYLMERKKKGSHRWMKLNFEVFTDTTYESTKMIEGVLYEMRVFAVN 729

  Fly   404 PYGLSEPSGESELLFIPDPKRGITKPKSATR--IAGDEKDKPKT---------GAGGM 450
            ..|:|:||..:: .|:|      ..|.||.:  ...|..|...|         ||||:
  Rat   730 AIGVSQPSMNTK-PFMP------IAPTSAPQHLTVEDVTDTTTTLKWRPPDRIGAGGI 780

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14964NP_647779.2 FN3 29..127 CDD:238020 12/32 (38%)
I-set 138..227 CDD:254352 20/96 (21%)
Ig 155..224 CDD:143165 16/68 (24%)
IG_like 243..323 CDD:214653 29/80 (36%)
Ig 250..323 CDD:299845 27/73 (37%)
FN3 327..411 CDD:238020 29/86 (34%)
Mybpc2XP_038960733.1 Ig 66..166 CDD:416386
Ig strand A 67..70 CDD:409353
Ig strand A' 73..76 CDD:409353
Ig strand B 81..88 CDD:409353
Ig strand C 97..102 CDD:409353
Ig strand C' 107..109 CDD:409353
Ig strand D 117..125 CDD:409353
Ig strand E 132..136 CDD:409353
Ig strand F 146..153 CDD:409353
Ig strand G 157..166 CDD:409353
THB 225..258 CDD:408162
Ig 272..353 CDD:416386
Ig strand A 272..274 CDD:409353
Ig strand A' 277..281 CDD:409353
Ig strand B 285..291 CDD:409353
Ig strand C 298..303 CDD:409353
Ig strand C' 306..309 CDD:409353
Ig strand D 314..319 CDD:409353
Ig strand E 322..327 CDD:409353
Ig strand F 336..342 CDD:409353
Ig strand G 345..353 CDD:409353
Ig 360..446 CDD:416386 8/19 (42%)
Ig strand B 374..380 CDD:409353
Ig strand C 387..392 CDD:409353
Ig strand C' 395..402 CDD:409353
Ig strand D 407..412 CDD:409353
Ig strand E 415..420 CDD:409353
Ig strand F 429..435 CDD:409353 3/5 (60%)
Ig strand G 438..446 CDD:409353 3/7 (43%)
IG_like 459..>521 CDD:214653 19/81 (23%)
Ig strand B 468..472 CDD:409353 1/3 (33%)
Ig strand C 480..484 CDD:409353 0/15 (0%)
Ig strand E 505..509 CDD:409353 1/3 (33%)
Ig_C5_MyBP-C 562..647 CDD:409475 29/84 (35%)
Ig strand B 574..578 CDD:409475 3/3 (100%)
Ig strand C 587..591 CDD:409475 1/3 (33%)
Ig strand E 613..617 CDD:409475 1/3 (33%)
Ig strand F 627..632 CDD:409475 1/4 (25%)
Ig strand G 640..643 CDD:409475 0/2 (0%)
FN3 651..737 CDD:238020 29/86 (34%)
FN3 750..842 CDD:238020 9/31 (29%)
Ig_Titin_like 861..941 CDD:409406
Ig strand B 870..874 CDD:409406
Ig strand C 883..887 CDD:409406
Ig strand E 907..911 CDD:409406
Ig strand F 921..926 CDD:409406
Ig strand G 934..937 CDD:409406
FN3 946..1028 CDD:238020
I-set 1060..1149 CDD:400151
Ig strand A' 1068..1071 CDD:409353
Ig strand B 1075..1084 CDD:409353
Ig strand C 1089..1095 CDD:409353
Ig strand C' 1098..1100 CDD:409353
Ig strand D 1106..1110 CDD:409353
Ig strand E 1113..1121 CDD:409353
Ig strand F 1129..1136 CDD:409353
Ig strand G 1139..1149 CDD:409353
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000709
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X825
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.000

Return to query results.
Submit another query.