DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MnM and Mybpc3

DIOPT Version :10

Sequence 1:NP_647779.2 Gene:MnM / 38384 FlyBaseID:FBgn0035410 Length:1443 Species:Drosophila melanogaster
Sequence 2:XP_011237643.1 Gene:Mybpc3 / 17868 MGIID:102844 Length:1278 Species:Mus musculus


Alignment Length:516 Identity:126/516 - (24%)
Similarity:201/516 - (38%) Gaps:103/516 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 GRPKKNVHWKSAERPSPPGRPILTPVALPEQQPDVVNLRWDRPLHDGGSPITGYTVEHRRMGSPH 79
            |..:.|:..|..:.|..|..|.::.|.     .|...::|:.|.:|||.|:.||.:|.::..|..
Mouse   762 GEDQVNLTVKVIDVPDAPAAPKISNVG-----EDSCTVQWEPPAYDGGQPVLGYILERKKKKSYR 821

  Fly    80 WVRATPTPVDRCDVCISGLEPGWRYQFRCFAENIVGRSDASELSDPLTVTLQRNAITVPRFIDEL 144
            |:|.....:.........:..|..|:.|.:|.|.||.|..|..|.|..      .|..|.....|
Mouse   822 WMRLNFDLLRELSHEARRMIEGVAYEMRVYAVNAVGMSRPSPASQPFM------PIGPPGEPTHL 880

  Fly   145 VDTNAVEDERIEFRVRILGEPPPEIN-WFKDGYEI----------------FSSRRTKIVNDNEA 192
                ||||.. :..|.:...||..:. ...|||.:                .:.|.:.:|.|...
Mouse   881 ----AVEDVS-DTTVSLKWRPPERVGAGGLDGYSVEYCQEGCSEWTPALQGLTERTSMLVKDLPT 940

  Fly   193 SVLVI-----HQVALTDEGEIKCTATNRAGHVITKARLMVQ---APPKIRLPRTYEDGLIVEADE 249
            ...::     |.||            ...|.::||..:.||   ..|:::|||.....:..:..|
Mouse   941 GARLLFRVRAHNVA------------GPGGPIVTKEPVTVQEILQRPRLQLPRHLRQTIQKKVGE 993

  Fly   250 VLRLKVGVAGQPPPAITWLHEGEVIAPGGRFEVSNTEKNSLLKIDNVLREDRGEYMVKAWNRLGE 314
            .:.|.:...|:|.|.:||..||:.:| |....:.|:..:::|.|....|...|.|.|.......|
Mouse   994 PVNLLIPFQGKPRPQVTWTKEGQPLA-GEEVSIRNSPTDTILFIRAARRTHSGTYQVTVRIENME 1057

  Fly   315 DSTSFLVTVTARPNPPGTPKLNMSFGKSATLSWTAPLDDGGCKIGNYIV--------EYFRVGWN 371
            |..:.::.:..:|:||...::..::|.:..|.|..|.|||..:|..|.|        |:|.|   
Mouse  1058 DKATLILQIVDKPSPPQDIRIVETWGFNVALEWKPPQDDGNTEIWGYTVQKADKKTMEWFTV--- 1119

  Fly   372 VWLKAATTRALSTTLHDLIEGSEYKFRVKAENPYGLSEPSGES-ELLFIPDPKRGITKPKSATRI 435
                ....|.....:.:||.|:.|.|||.:.|..|.|:.:..: |.:|||.|  |||        
Mouse  1120 ----LEHYRRTHCVVSELIIGNGYYFRVFSHNMVGSSDKAAATKEPVFIPRP--GIT-------- 1170

  Fly   436 AGDEKDKPKTGAGGMQVPPRRKTL------SPPRPQADAS--TGMSPKQSPSAKRKPKPQL 488
                           ..||:.|.|      |..:|.|:.|  .|.:.....:.:..|||::
Mouse  1171 ---------------YEPPKYKALDFSEAPSFTQPLANRSIIAGYNAILCCAVRGSPKPKI 1216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MnMNP_647779.2 FN3 29..127 CDD:238020 28/97 (29%)
I-set 138..227 CDD:400151 21/110 (19%)
Ig strand B 155..159 CDD:409565 0/3 (0%)
Ig strand C 168..172 CDD:409565 0/4 (0%)
Ig strand E 194..197 CDD:409565 0/2 (0%)
Ig strand F 207..212 CDD:409565 0/4 (0%)
Ig strand G 220..223 CDD:409565 1/2 (50%)
Ig 243..323 CDD:472250 20/79 (25%)
Ig strand B 251..255 CDD:409353 1/3 (33%)
Ig strand C 264..268 CDD:409353 1/3 (33%)
Ig strand E 289..293 CDD:409353 1/3 (33%)
Ig strand F 303..308 CDD:409353 2/4 (50%)
Ig strand G 316..319 CDD:409353 0/2 (0%)
FN3 327..411 CDD:238020 27/91 (30%)
PHA03247 <420..718 CDD:223021 17/77 (22%)
Mybpc3XP_011237643.1 Ig 20..102 CDD:472250
Ig strand B 35..39 CDD:409353
Ig strand C 47..51 CDD:409353
Ig strand E 72..76 CDD:409353
Ig strand F 86..91 CDD:409353
Ig strand G 95..98 CDD:409353
IgI_C1_MyBP-C_like 162..262 CDD:409554
Ig strand A 163..166 CDD:409554
Ig strand A' 169..172 CDD:409554
Ig strand B 177..184 CDD:409554
Ig strand C 193..198 CDD:409554
Ig strand C' 203..205 CDD:409554
Ig strand D 213..221 CDD:409554
Ig strand E 228..232 CDD:409554
Ig strand F 242..249 CDD:409554
Ig strand G 253..262 CDD:409554
THB 324..357 CDD:465725
IgI_C2_MyBP-C-like 371..453 CDD:409559
Ig strand A 371..373 CDD:409559
Ig strand A' 376..380 CDD:409559
Ig strand B 384..390 CDD:409559
Ig strand C 397..402 CDD:409559
Ig strand C' 405..408 CDD:409559
Ig strand D 414..419 CDD:409559
Ig strand E 422..427 CDD:409559
Ig strand F 436..442 CDD:409559
Ig strand G 445..453 CDD:409559
Ig 460..544 CDD:472250
Ig strand B 475..479 CDD:409353
Ig strand E 514..518 CDD:409353
Ig strand F 528..533 CDD:409353
Ig 557..621 CDD:472250
Ig strand B 566..570 CDD:409353
Ig strand C 578..582 CDD:409353
Ig strand E 603..607 CDD:409353
FN3 638..>981 CDD:442628 57/246 (23%)
Ig_C5_MyBP-C 660..772 CDD:409475 2/9 (22%)
Ig strand A 662..666 CDD:409475
Ig strand B 670..677 CDD:409475
Ig strand C 683..718 CDD:409475
Ig strand C' 719..721 CDD:409475
Ig strand D 729..735 CDD:409475
Ig strand E 736..743 CDD:409475
Ig strand F 751..759 CDD:409475
Ig strand G 762..772 CDD:409475 2/9 (22%)
Ig_Titin_like 986..1066 CDD:409406 20/80 (25%)
Ig strand A 986..990 CDD:409406 0/3 (0%)
Ig strand B 995..1001 CDD:409406 1/5 (20%)
Ig strand C 1007..1013 CDD:409406 3/5 (60%)
Ig strand D 1024..1029 CDD:409406 1/4 (25%)
Ig strand E 1030..1036 CDD:409406 1/5 (20%)
Ig strand F 1045..1053 CDD:409406 3/7 (43%)
Ig strand G 1056..1066 CDD:409406 2/9 (22%)
FN3 1070..1153 CDD:238020 26/89 (29%)
I-set 1185..1274 CDD:400151 8/32 (25%)
Ig strand B 1202..1206 CDD:409353 0/3 (0%)
Ig strand C 1215..1219 CDD:409353 0/2 (0%)
Ig strand E 1240..1244 CDD:409353
Ig strand F 1254..1259 CDD:409353
Ig strand G 1267..1270 CDD:409353
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.