DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG14964 and igfn1.4

Sequence 1:NP_647779.2 Gene:CG14964 FlyBaseID:FBgn0035410 Length:1443 Species:Drosophila melanogaster
Sequence 2:XP_021333034.1 Gene:igfn1.4 ZFINID:ZDB-GENE-131125-85 Length:1189 Species:Danio rerio

Alignment Length:483 Identity:122/484 (25%)
Similarity:190/484 (39%) Gaps:107/484 (22%)


  Fly    27 ERPSPPGRPILTPVALPEQQPDVVNLRWDRPLHDGGSPITGYTVEHRRMGSPHWVRATPTPVDRC 91
            ::|.||    ..||.:.|....|:.|:|:.|..:|||.:|.|.:|..::|...|.:....|.:..
Zfish   685 DKPGPP----QGPVEVNETTSSVLELKWNPPKDEGGSAVTNYIIEQLQVGQNTWQKVGDIPANHL 745

  Fly    92 DVCISGLEPGWRYQFRCFAENIVGRSDASEL--------------SDPLTVTLQRNAITVPRFID 142
            :.....:..|.||.:|.:|||..|.|:|.|.              :.|..|:..:|.|.      
Zfish   746 NFRDRSVSLGKRYIYRIYAENPEGISEALETEKIMAGSLMFPGPPTQPKVVSAFKNCIN------ 804

  Fly   143 ELVDTNAVEDERIEFRVRILGEPPPEINWFKD------GYEIFSSRRTKIVND----NEASVLV- 196
                               |...|||    ||      ||:|  .:|.|..|.    |.....: 
Zfish   805 -------------------LSWTPPE----KDGGNKILGYQI--EKRKKDTNQWVTLNSVKDPIK 844

  Fly   197 -----IHQVALTDEGEIKCTATNR--AGHVITKARLMVQAPPKIRLP--RTYEDGLIVEADEVLR 252
                 :..|:...|.|.:..|.|.  ||...|.:.::....|.:: |  :..||.::|.:...:|
Zfish   845 GLKYGVKDVSEGSEYEFRVIAINSSGAGEPSTPSEMVCAKNPNMK-PHFKDPEDFMVVRSGNSIR 908

  Fly   253 LKVGVAGQPPPAITWLHEGEVIAPGGRFEVSNTEKNSLLKIDNVLREDRGEYMVKAWNRLGEDST 317
            :|:.....|.|.|.||..||.::|..:  :.:.:....|.:.:....|.|.|.:.|.|..|:.|.
Zfish   909 IKINYEAAPQPDIKWLKNGEPVSPWNK--IIHDDGTCTLIVPSSKYSDSGVYTIVAKNSSGQASF 971

  Fly   318 SFLVTVTARPNPPGTPKL-NMSFGKSATLSW-TAPLDDGGCKIGNYIVEYFRVGWNVWLKAATTR 380
            ...|.||..|.|||..:| .:.||| ..:.| .:|..|...:: :|:||.......:| :.....
Zfish   972 DIEVRVTDEPRPPGPVELEQLVFGK-VIIRWLPSPDHDRDDRL-HYMVEEQNSNSRIW-RTIADH 1033

  Fly   381 ALSTTLHDLIE-GSEYKFRVKAENPYGLSEPSGESELLFIPDPKRGITK-----PKSATRIAGDE 439
            .|.||....:: |.||.||:.|:|..|||:||        ..|..|:..     |.:...:...|
Zfish  1034 LLCTTYTTTVQPGQEYHFRIYAKNDMGLSDPS--------DSPTWGVNSNKVLAPSTVPTMVNLE 1090

  Fly   440 KDKPKTGAGGMQVPPR----RKTLSPPR 463
            |            ||.    .|..|||:
Zfish  1091 K------------PPSILVPLKLHSPPK 1106

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14964NP_647779.2 FN3 29..127 CDD:238020 31/112 (28%)
I-set 138..227 CDD:254352 21/107 (20%)
Ig 155..224 CDD:143165 21/87 (24%)
IG_like 243..323 CDD:214653 20/80 (25%)
Ig 250..323 CDD:299845 19/73 (26%)
FN3 327..411 CDD:238020 29/87 (33%)
igfn1.4XP_021333034.1 I-set 16..107 CDD:254352
I-set 281..366 CDD:333254
IG_like 512..575 CDD:214653
I-set 589..683 CDD:333254
FN3 687..779 CDD:238020 30/96 (31%)
FN3 787..879 CDD:238020 25/123 (20%)
I-set 899..977 CDD:254352 20/80 (25%)
FN3 981..1067 CDD:238020 30/97 (31%)
I-set 1093..1182 CDD:254352 5/15 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG0613
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.