DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG14963 and CG13905

Sequence 1:NP_647778.1 Gene:CG14963 FlyBaseID:FBgn0035409 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_612072.2 Gene:CG13905 FlyBaseID:FBgn0035176 Length:238 Species:Drosophila melanogaster

Alignment Length:230 Identity:81/231 (35%)
Similarity:123/231 (53%) Gaps:18/231 (8%)


  Fly     5 LDWLLLITLASGSLALWSPQLVPPTVGLLAP-GPPATLAPPPTLSQDLEEIQRLIQSKPLNQLLV 68
            |.::.|:...|.:.|:.:|         :.| |...|||.....:.:|:.:.|.|....:.:|:.
  Fly     9 LGFMCLVAFPSATPAILAP---------IRPYGQNGTLAQQNNFALELKSVIRQIPVDNIEKLVQ 64

  Fly    69 RYLINDAQFQAFVRIINSNAAVTARWRLLSQPELILFLQWTDQQLLASGGS---FELEEQRLKVS 130
            .||:||.:||..:|.|||..|.....:|::|||:....||..|||:.|||.   |:..|  |::.
  Fly    65 TYLLNDIEFQGVIRAINSLPAYRFYRQLINQPEVRQLQQWITQQLILSGGGPKIFDYLE--LEIK 127

  Fly   131 LLNQFPYWSGTVFGWQGFLNE-VQLYFPLYAIRAHIDAKVLQQG-IFAQFWSRLQGLRVMYERWL 193
            :||::||||..|.|.|||..| ||:| |:..||:.::....|.. ..::.|.||..||.:|||.|
  Fly   128 ILNKYPYWSQIVNGIQGFQAEFVQIY-PVQLIRSFLEPSATQTSPQLSELWRRLVALRPVYERVL 191

  Fly   194 TTVETTQVLAELQKAGIDTVQLDGIIRELLGWNAV 228
            .|.....:.||||:.|:|...:|.:||...||:.|
  Fly   192 ATPPGKAITAELQRLGVDVGGVDALIRYQFGWSNV 226

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14963NP_647778.1 Ins_allergen_rp 49..216 CDD:284230 65/172 (38%)
CG13905NP_612072.2 Ins_allergen_rp 42..214 CDD:284230 65/175 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C130867430
eggNOG 1 0.900 E1_2F7W0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21163
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.