DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG14963 and CG15712

Sequence 1:NP_647778.1 Gene:CG14963 FlyBaseID:FBgn0035409 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_611131.2 Gene:CG15712 FlyBaseID:FBgn0034131 Length:214 Species:Drosophila melanogaster

Alignment Length:199 Identity:35/200 (18%)
Similarity:79/200 (40%) Gaps:35/200 (18%)


  Fly    47 LSQDLEEIQRLIQSKPLNQLLVRYLINDAQFQAFVRIINSNAAVTARWRLLSQPELILFLQWTDQ 111
            |.:||::...|:..:.:..:..||.|.|.:|:..|..:.|:..:....::.:.|:.:..:.:...
  Fly    26 LREDLKDFVALVPRRRIGFIAARYYIFDPKFRQAVEFVRSDEFIATWQQVRATPDFVNIINYVSD 90

  Fly   112 QLLASGGSFELEEQRLKVSLLNQFP------YWSGTV------------FGWQGFLNEVQLYFPL 158
            .    |..:::      .:|::..|      ..|.||            |.|     :|....|.
  Fly    91 Y----GSGYDI------TTLVDSLPTRLRAYQLSRTVPVELMLRRDLNTFLW-----DVIHSLPR 140

  Fly   159 YAIRAHIDAKVLQQGIFAQFWSRLQG--LRVMYERWLTTVETTQVLAELQKAGIDTVQLDGIIRE 221
            ..|.:.|..|..|...||:.:..|:.  .:.:.:|...:.:....:.:|.:..|:..::..|:.|
  Fly   141 TRIYSLIAQKSKQSTEFAKLYKALRDKEFKELVQRARLSRDLQAPIKKLSQKSINVDEILQIVFE 205

  Fly   222 LLGW 225
            ::.|
  Fly   206 VISW 209

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14963NP_647778.1 Ins_allergen_rp 49..216 CDD:284230 31/187 (17%)
CG15712NP_611131.2 Ins_allergen_rp 25..200 CDD:284230 32/189 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C130867687
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21163
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.