DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG15812 and lola

Sequence 1:NP_523897.2 Gene:CG15812 FlyBaseID:FBgn0035405 Length:518 Species:Drosophila melanogaster
Sequence 2:NP_788308.3 Gene:lola FlyBaseID:FBgn0283521 Length:970 Species:Drosophila melanogaster

Alignment Length:667 Identity:126/668 (19%)
Similarity:221/668 (33%) Gaps:214/668 (32%)


  Fly     4 LKWMGHSSTIMDIQRSLRNDNQHCEVVLASRDGVRVRAHLFVLSTCSELMRNLLVDVPRGQEATI 68
            |:|..|.||::.:..:|..:....:..||: :|..::||..|||.||.....||.: ...:....
  Fly     9 LRWNNHQSTLISVFDTLLENETLVDCTLAA-EGKFLKAHKVVLSACSPYFATLLQE-QYDKHPIF 71

  Fly    69 MLPDIRGDLLECMLSFIYMGETSLPSASLPEFLEAINLLGIKSA--------------------- 112
            :|.|::...|..|:.::|.||.::....|...|:|...|.||..                     
  Fly    72 ILKDVKYQELRAMMDYMYRGEVNISQDQLAALLKAAESLQIKGLSDNRTGGGVAPKPESSGHHRG 136

  Fly   113 ----------------------------ISFECNPSASP--------------PSVDVENHSL-- 133
                                        :|.....|:||              .:.|..|.|:  
  Fly   137 GKLSGAYTLEQTKRARLATGGAMDTSGDVSGSREGSSSPSRRRRKVRRRSMENDAHDNSNSSVLQ 201

  Fly   134 AVESAKSI---TGLQIAEAELLDDEEEPHPMVSVPATTLAGSQHQPSHSSRSLEYIDVYEPPKIT 195
            |..|.:||   ||..:|.:.|:..:....|.....:...:..|.||..|:...:..   |..|:|
  Fly   202 AAASNQSILQQTGAGLAVSALVTTQLSSGPAAGTSSQASSTQQQQPLTSTNVTKKT---ESAKLT 263

  Fly   196 YS----IEHMDGSSSGNQFILTENTGTFTITQSASSLSKIEADETGTSGAEVDLGDD-DVDADLA 255
            .|    ......|::..|..|.:...  ..|..|.:...::|...|  ||:...||| |:|...|
  Fly   264 SSTAAPASGASASAAVQQAHLHQQQA--QTTSDAINTENVQAQSQG--GAQGVQGDDEDIDEGSA 324

  Fly   256 ----------------------------------EDSEEHESQMIDEEFAQADPLMELEAGTEMD 286
                                              :.|..|:.::.|...:.....|.:|...|.|
  Fly   325 VGGPNSATGPNPASASASAVHAGVVVKQLASVVDKSSSNHKHKIKDNSVSSVGSEMVIEPKAEYD 389

  Fly   287 D---DDDVHDQLVD------EEIDDKPRKLGGGK------------------------TRIRRPI 318
            |   |::|.|..:|      ||:|.......||:                        .:.|.|.
  Fly   390 DDAHDENVEDLTLDEEDMTMEELDQTAGTSQGGEGSSQTYATWQHDRSQDELGLMAQDAQQRDPQ 454

  Fly   319 SAKAVKRLSDCKPTRIQQFAALKREVKDDINDALDLAADAVIIEG-----LSLQK----AADRFD 374
            ::|..|.         :|....:.|.  :::|.|..:.|.||.:.     |.::|    .|.:.:
  Fly   455 ASKQDKG---------EQTEGAQDEF--ELDDCLLESNDIVITQNKDGFVLHVKKLGNITAAKLE 508

  Fly   375 ISKTVLWRRVR-----TNPAYMRNNRERPSLQEAYERLKNGHS-------------LKSISSELQ 421
            .::.|..::.:     |.||    .:..|::.|........||             :|..|||.:
  Fly   509 ENQAVAQQQGQAAVTVTGPA----GQPTPTITELLNAAAASHSEPKPTLTTLTSTPIKLPSSECE 569

  Fly   422 -------IP-MSTLHRHKVRLSAQGRLPNFVSCRKRDNTPKDELRDKLAKAVHACLNEGMSQNHA 478
                   || .:|:..|....|:....|:.:.             ..:::..|.  .|...|:..
  Fly   570 LINIKKIIPATTTIATHHPHTSSTIIHPHHII-------------QHVSQEPHH--QEHHQQHQT 619

  Fly   479 ANLFEIPKSTLWRHLQR 495
            .::.|:|:::...|.|:
  Fly   620 IHIEEVPQTSQQHHQQQ 636

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG15812NP_523897.2 BTB 20..113 CDD:279045 26/142 (18%)
BTB 35..118 CDD:197585 24/132 (18%)
HTH_psq 348..392 CDD:283007 12/58 (21%)
HTH_psq 458..501 CDD:283007 7/39 (18%)
lolaNP_788308.3 BTB 22..117 CDD:279045 26/97 (27%)
BTB 33..117 CDD:197585 25/86 (29%)
C2H2 Zn finger 905..925 CDD:275368
C2H2 Zn finger 935..955 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR23110
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.