DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG15812 and lov

Sequence 1:NP_523897.2 Gene:CG15812 FlyBaseID:FBgn0035405 Length:518 Species:Drosophila melanogaster
Sequence 2:NP_611994.3 Gene:lov FlyBaseID:FBgn0266129 Length:1143 Species:Drosophila melanogaster

Alignment Length:469 Identity:99/470 (21%)
Similarity:166/470 (35%) Gaps:128/470 (27%)


  Fly     4 LKWMGHSSTIMDIQRSLRNDNQHCEVVLASRDGVRVRAHLFVLSTCSELMRNLLVDVPRGQEATI 68
            |:|..|.:.|:....:|.......:|.|...: ..:|||..|||.||...:.:..:.| .:...|
  Fly   117 LRWNNHQNHILRAFDALLKTKTLVDVTLVCAE-TSIRAHKMVLSACSPFFQRVFAETP-CKHPVI 179

  Fly    69 MLPDIRGDLLECMLSFIYMGETSLPSASLPEFLEAINLLGIKSAISFEC-----NPSASPPSVDV 128
            :|.|.||.:::.::.|:|.||.|:|...|...::|...|.::..:....     .|:|||....:
  Fly   180 VLKDFRGWVVQAIVDFMYRGEISVPQQRLQTLIQAGESLQVRGLVESSVPEHTPTPAASPDDFGM 244

  Fly   129 ENHSLAVESAKSITGLQIAEAELLDDEEEPHPMVS--------VPATTLAGS-----------QH 174
            .:.|:...:.                |:|...||.        :|:..|.|:           :.
  Fly   245 LDTSMLSSTF----------------EDECPTMVRPSKGGKLLMPSARLFGNASSAIAALGLRRK 293

  Fly   175 QPSHSSRSLEYIDVYEPPKITYSIEHMDGSS-------------SGNQFILTENTGTFTITQS-A 225
            :...|.|.||            |.:.:.|||             ||      :....||:.:: |
  Fly   294 REQESDRDLE------------SDQELGGSSPMPRRKQARPRRRSG------DVPHDFTLNKTDA 340

  Fly   226 SSLSKI--------------EADETGTSGAEVDLGDDDVDADLAEDSEEHESQMIDEEFAQADPL 276
            .||..:              ||.:...|..|.:.........|.|.::|.:| |.:|...|...|
  Fly   341 ESLQTVIKHELLERAERDQEEAPDQDNSQGEAEKISSSPAKTLVERAKEQKS-MKEEGSDQPRSL 404

  Fly   277 MELEAGTEMDDDDDVHDQLVDEEIDDKPRKLGGGKTRIRRPISAKAVKRLSDCKPTRIQQFAALK 341
            .|.....|:||:|| .||..:||.:....:|......:||..:|.|...            ||:.
  Fly   405 NENHHQLELDDEDD-DDQDHEEEEEQDIEELIHTTNELRRQAAAAAANA------------AAMS 456

  Fly   342 REVKDDINDALDLAADAVIIEGLSLQKAADRFDISKTVLWRRVRTNPAYM----RNNRERPSLQE 402
            ......::|..:                    |:..|...:.:.:.|:..    .||.....||:
  Fly   457 PNPSPCLSDGPE--------------------DLCTTKKGKELISGPSSSADCESNNNNSSKLQD 501

  Fly   403 AYERLKNGHSLKSI 416
            ..:|:.  .|||.|
  Fly   502 NNQRIM--LSLKDI 513

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG15812NP_523897.2 BTB 20..113 CDD:279045 26/93 (28%)
BTB 35..118 CDD:197585 23/88 (26%)
HTH_psq 348..392 CDD:283007 4/48 (8%)
HTH_psq 458..501 CDD:283007
lovNP_611994.3 BTB 130..225 CDD:279045 26/97 (27%)
BTB 141..226 CDD:197585 25/87 (29%)
HTH_psq 791..834 CDD:283007
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR23110
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.